Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 tRNA_Ser_2 IGR489 IGR492 IGR488 IGR490 IGR487 IGR491 IGR486 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 gapA, - CPn0624 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0618

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lplA  

Definition:
lipoate protein ligase

Gene Start:
712306

Gene Stop:
713013

Gene Length:
708

Molecular Weight*:
27188

pI*:
6.70

Net Charge*:
-1.69

EC:
6.-.-.-  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
This enzyme joins lipoic acid to protein, through
an amide
linkage between the carboxyl group of lioate and
the epsilon-amino
group of a lysine residue.

Blast Summary:  PSI-Blast Search
CPn0618 is similar to MG270, a predicted
lipoate protein ligase in M. genitalium:
residues 43-193 are 27% similar to residues
43-195 of MG270.

CPn0618 is orthologously related to CT499:
residues 5-234 are 53% similar to residues
4-233 of CT499.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0095
COG name: Lipoate-protein ligase A
Functional Class:  H
The phylogenetic pattern of COG0095 is ---kyQvceB----gp--IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 47 to 160 (E-value = 6.1e-24) place CPn0618 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

PDB Hit:


Gene Protein Sequence:
MPTTNCIFLDLRGHSILHQLQIEEALLRVANQNFCIINSGAKDSIVLGIS
RNLNQDVHISRAQADHIPIIRRYSGGGTVFIDSNTLMVSWIMNSSEASAQ
PQELLAWTYGIYSPLLPNTFSIRENDYVLGHKKIGGNAQYIQRHRWVHHT
TFLWDIDLDKLSYYLPIPQQQPTYRNQRSHEEFLTTLRPWFPSRDDFLER
IKASGSLLFTWEEFLDNELEEILAQPHRKATTVLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCACCACTAACTGTATTTTCCTAGATTTACGGGGACACTCTATTCT
TCACCAACTGCAAATTGAAGAGGCTTTACTAAGAGTCGCGAATCAAAATT
TTTGCATTATAAATTCAGGTGCCAAAGACTCTATAGTTTTAGGAATTTCT
CGAAACTTGAATCAAGACGTTCATATTTCTAGAGCACAAGCAGACCATAT
TCCTATCATACGCCGCTATAGTGGAGGGGGGACGGTATTCATAGATTCCA
ATACCTTGATGGTATCTTGGATTATGAACAGTTCAGAAGCTTCTGCCCAA
CCTCAGGAATTATTAGCATGGACTTATGGCATCTATAGTCCACTACTTCC
TAATACCTTTTCTATTCGAGAAAACGACTATGTTCTTGGTCATAAGAAAA
TAGGAGGTAATGCACAATATATTCAAAGACATCGCTGGGTACATCACACG
ACATTTCTGTGGGATATCGACCTAGATAAGTTGTCCTACTACCTGCCAAT
TCCTCAACAACAACCTACCTACCGTAATCAACGCTCTCACGAAGAATTTT
TGACTACGTTACGTCCTTGGTTCCCCTCTCGCGATGACTTCTTGGAAAGG
ATCAAGGCATCTGGTAGTTTGTTGTTTACCTGGGAAGAATTTCTTGATAA
TGAGCTAGAAGAAATTCTTGCTCAACCTCATCGTAAAGCAACTACAGTAC
TAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy