Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_3 tRNA_Ser_2 IGR489 IGR488 IGR490 IGR485 IGR487 IGR491 IGR486 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 adt, - CPn0614 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 adt, - CPn0614 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 pgsA, - CPn0615 ruvC, - CPn0621 ruvA, - CPn0620 CPn0623 CPn0622 adt, - CPn0614 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0617

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gidA  

Definition:
glucose inhibited division protein A (oxidoreductase)

Gene Start:
710484

Gene Stop:
712319

Gene Length:
1836

Molecular Weight*:
67556

pI*:
7.00

Net Charge*:
0.44

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:
The GIDA (glucose inhibited division protein A) function is unknown at this time. It appears to be associated with oxidoreductase capacity and NAD/FAD-utilization.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glucose inhibited division protein A (oxidoreductase) sequences; e.g. residues 1-610 are 78% similar to CT498, residues 8-607 are 43% similar to TP0044; residues 8-607 are 42% similar to UU039; residues 6-608 are 40% similar to MG379; residues 5-607 are 49% similar to GIDA_PSEPU; and residues 8-607 are 49% similar to GIDA_AQUAE. Also similar to GIDA_ECOLI, GIDA_COXBU, GIDA_HAEIN, GIDA_HELPY, GIDA_BORBU, GIDA_BACSU, GIDA_BUCAP, GIDA_LACLC, GIDA_MYCPN, and others.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0445
COG name: NAD/FAD-utilizing enzyme apparently involved in cell division
Functional Class:  D
The phylogenetic pattern of COG0445 is ----yqvceb-hujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 9-602 span 9 regions of similarity to blocks BL01280A-I (Glucose inhibited division protein A family proteins) with a combined E-value of 2.8e-211.

ProDom Summary:  Protein Domain Search
Residues 37-308 are 54% similar to a defined domain of GIDA_PSEPU.
Residues 309-425 are 63% similar to a defined domain of GIDA_HELPY.
Residues 426-607 are 42% similar to a defined domain of GIDA_PSEPU.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 407 (E-value = 8.6e-209) place CPn0617 in the GIDA family which is described as Glucose inhibited division protein A (PF01134)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
464  
491

PDB Hit:


Gene Protein Sequence:
MWTHPIAYDVIVVGAGHAGCEAAYCSAKMGVSVLMLTSNLDTIAKLSCNP
AVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQV
DKQLYHIHMKRLLENTPGLHIMQATVESLLDKEGVISGVTTKEGWMFSGK
TVVLSSGTFMRGLIHIGDRNFSGGRLGDPSSQGLSEDLKKRGFPISRLKT
GTPPRLLASSINFSCMEEQPGDLGVGFVHRTEPFQPPLPQLSCFITHTME
KTKAIISANLHRSALYGGCIEGVGPRYCPSIEDKIVKFSDKERHHVFLEP
EGLHTQEIYANGLSTSMPFDVQYDMIRSVLGLENAIITRPAYAIEYDYIH
GNVIHPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVFNRP
PFIPSRQESYIGVMLDDLTTQILDEPYRMFTGRAEHRLLLRQDNACARLS
HYGYELGLLSEERYELVKKQNQLLEEEKVRLQKTFRQYGQSVVSLAKALS
RPEVSYDMLREAFPNDIRDLGAVLNASLEMEIKYSGYIDRQKILIQSLEK
AESLLIPEDLDYKQITALSLEAQEKLAKFTPRTLGSASRISGIASADIQV
LMIALKKHAHH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGACTCACCCAATTGCTTATGATGTGATTGTAGTGGGAGCTGGACA
TGCAGGTTGTGAGGCAGCATATTGCTCTGCAAAGATGGGTGTCTCCGTTC
TTATGCTCACCTCCAATTTGGATACTATTGCCAAGTTGAGTTGCAATCCT
GCTGTCGGTGGTATCGGCAAAGGGCACATTGTTCGAGAGATCGATGCCCT
TGGTGGTATTATGGCGGAAGTGACAGATCAATCTGGCATACAATTTCGCA
TTCTGAACCAAACCAAGGGACCTGCTGTCCGAGCACCACGAGCTCAAGTA
GATAAGCAACTTTATCATATTCATATGAAACGTCTTTTGGAGAATACTCC
GGGCCTTCATATTATGCAGGCCACTGTAGAGTCTCTATTAGATAAAGAAG
GTGTGATTTCTGGAGTCACTACTAAAGAAGGCTGGATGTTCTCAGGAAAG
ACTGTAGTTCTTTCTTCGGGAACTTTTATGCGCGGCCTAATTCATATTGG
GGACCGTAATTTCTCTGGAGGACGTTTAGGCGACCCTTCATCACAAGGTT
TATCGGAAGATCTTAAAAAACGTGGTTTTCCTATAAGCAGATTGAAAACT
GGGACCCCTCCCCGTTTACTAGCCTCTTCTATAAATTTTTCCTGCATGGA
AGAGCAACCTGGAGATTTAGGTGTGGGTTTTGTACACAGAACCGAGCCTT
TTCAGCCTCCTTTACCACAACTTTCTTGTTTCATTACCCACACCATGGAA
AAAACTAAGGCAATCATTTCAGCAAACTTACATCGTTCGGCACTTTATGG
GGGCTGCATTGAAGGGGTAGGTCCTCGCTATTGTCCTTCTATAGAAGATA
AAATTGTAAAGTTCTCGGACAAAGAACGTCACCACGTCTTTCTAGAGCCA
GAAGGGCTGCATACCCAAGAGATCTATGCTAATGGGTTATCTACTTCTAT
GCCTTTTGATGTACAATACGATATGATCCGTTCTGTACTGGGGTTAGAAA
ATGCAATTATCACTCGACCAGCTTATGCTATAGAATATGATTATATTCAC
GGCAATGTGATCCACCCCACACTGGAGAGTAAACTTATTGAAGGGCTCTT
CTTATGTGGGCAGATTAATGGCACCACAGGTTATGAAGAAGCCGCAGCCC
AAGGGTTAATTGCCGGCATTAACGCTGTGAACAAGGTTTTCAACAGGCCT
CCTTTTATTCCTTCACGCCAAGAATCTTACATCGGCGTCATGCTAGACGA
TCTCACCACACAGATTTTGGATGAACCTTACCGCATGTTTACAGGAAGAG
CAGAACACCGGCTCTTATTAAGACAAGATAATGCGTGTGCTCGACTATCG
CACTATGGTTATGAATTAGGGTTACTCTCAGAGGAACGTTACGAACTTGT
CAAAAAGCAAAACCAGCTATTAGAAGAAGAAAAGGTTCGCCTCCAAAAGA
CATTTAGGCAGTACGGCCAGTCTGTAGTCTCTTTAGCAAAAGCACTATCT
CGTCCTGAAGTTTCTTATGACATGCTTAGAGAAGCATTCCCAAATGATAT
CCGTGATTTAGGAGCGGTTCTCAATGCCTCCTTAGAAATGGAAATCAAAT
ATTCTGGATATATAGATCGCCAGAAAATTCTGATTCAGAGTTTAGAAAAA
GCCGAGAGTTTACTAATTCCAGAAGACTTAGATTATAAGCAGATAACAGC
CTTAAGCTTAGAAGCTCAAGAGAAATTAGCGAAATTTACACCTCGAACTC
TTGGTTCTGCATCGAGAATATCGGGCATAGCTTCTGCTGACATTCAAGTT
TTGATGATAGCTTTAAAAAAACATGCCCACCACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy