Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_2 IGR489 IGR483 IGR488 IGR484 IGR485 IGR487 IGR486 ndk, - CPn0619 ruvC, - CPn0621 pgsA, - CPn0615 ruvA, - CPn0620 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 ruvC, - CPn0621 pgsA, - CPn0615 ruvA, - CPn0620 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 ndk, - CPn0619 ruvC, - CPn0621 pgsA, - CPn0615 ruvA, - CPn0620 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0616

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
replicative DNA helicase

Gene Start:
708791

Gene Stop:
710140

Gene Length:
1350

Molecular Weight*:
51032

pI*:
6.30

Net Charge*:
-4.55

EC:
3.6.1.-  

Functional Class:
DNA metabolism  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
In E.coli, the DnaB protein is involved in initiation and elongation during chromosome replication. It is a homomeric enzyme.

Blast Summary:  PSI-Blast Search
CPn0616 is similar to TP0058 in T. pallidum, MG094 in M. genitalium and UU550 in U. urealyticum. They are all predicted replicative DNA helicases.

CPn0616 is orthologously related to CT497:
residues 1-446 are 74% similar to residues 24-469 of CT497. CPn0616 is also similar to pCT01, a plasmid factor PGP1-D: DNA helicase.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 94 (E-value = 2.2e-25) place CPn0616 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 182 to 382 (E-value = 6.8e-124) place CPn0616 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

PDB Hit:


Gene Protein Sequence:
MIVLGCMLTGVHYLNLAANQLYEEDFYYLEHKIIFRVLQDAFKQDKPIDV
HLAGEELKRHNQITVIGGPSYLITLAEFAGTAAYLEEYVDIIRSKSILRK
MISTAKEIEKRALEQPKNVAEALDEAQNSFFKISQSTSVSQYTLVADKLR
GLTTTTDKPYLVQLQERQELFLQNAQGDNKSFFTGIPTHFIDLDQLIHGF
SPSNLMILAARPAMGKTALALNIAENLCFQNRLPIGIFSLEMTVDQLIHR
MICSRSEVDSKKISIGDLSGHDFQRIVSVINEMQEHTLLIDDQPGLKVSD
LRARARRMKESYDIQFLIIDYLQLLSGSGTLRATESRQTEISEISRMLKT
LARELNIPILCLSQLSRKVEDRANHRPMMSDLRESGSIEQDSDLVMFLLR
REYYDPNDKPGTAELIIAKNRHGSIGSVPLVFEKELARFRNYSAFECIS$


Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGTTTTAGGTTGCATGCTGACAGGGGTACATTATCTAAATCTTGC
AGCCAACCAACTCTACGAAGAAGATTTTTATTACCTTGAACATAAAATTA
TTTTTCGAGTCCTCCAAGATGCCTTCAAGCAAGATAAACCTATCGATGTT
CACTTAGCTGGAGAAGAACTCAAACGGCACAACCAGATTACTGTAATTGG
GGGCCCTTCGTATCTAATTACTTTAGCCGAATTTGCAGGTACCGCAGCCT
ATCTTGAAGAATACGTAGACATCATCCGATCGAAGTCGATTCTAAGGAAG
ATGATTTCTACAGCAAAAGAAATCGAAAAAAGAGCTTTAGAGCAGCCGAA
AAATGTTGCCGAAGCCTTAGATGAAGCTCAGAATTCTTTTTTTAAAATCA
GCCAATCAACATCGGTAAGTCAGTACACTTTAGTTGCTGACAAATTACGC
GGGTTAACAACAACTACAGATAAGCCTTACCTTGTACAATTACAAGAGAG
ACAAGAATTATTTTTACAGAATGCTCAAGGAGACAATAAGTCTTTCTTCA
CTGGCATTCCCACACACTTTATTGATTTAGACCAGCTGATTCACGGATTT
TCTCCCTCAAATTTGATGATCTTAGCTGCCCGCCCTGCCATGGGGAAAAC
AGCACTCGCTTTGAATATTGCAGAGAATCTTTGTTTTCAAAACCGCCTCC
CCATTGGAATTTTTTCTTTAGAGATGACAGTGGATCAGCTGATTCATCGT
ATGATTTGCTCTCGATCCGAAGTTGACTCTAAAAAAATCTCTATAGGCGA
CCTTTCCGGTCATGACTTTCAAAGAATTGTTTCGGTAATCAATGAAATGC
AGGAACACACTTTGCTCATTGATGATCAGCCAGGGTTAAAAGTTTCTGAT
CTACGAGCTCGGGCTCGTAGAATGAAGGAAAGCTATGATATTCAATTTCT
CATTATTGATTATTTACAATTACTTTCCGGCTCAGGGACTTTGCGTGCTA
CAGAAAGTCGTCAAACAGAAATTTCAGAGATTTCCCGAATGTTGAAGACT
CTTGCCCGTGAGTTAAACATTCCGATTCTTTGTCTTTCACAGCTTTCTCG
AAAAGTTGAGGATCGGGCAAATCATCGTCCGATGATGAGTGATCTTCGGG
AAAGTGGAAGTATTGAGCAAGATTCGGATTTAGTGATGTTCTTACTTCGT
AGAGAATATTATGATCCCAATGATAAGCCTGGCACTGCAGAACTTATTAT
AGCAAAAAACCGTCATGGTTCTATAGGTTCTGTCCCTCTAGTTTTTGAAA
AAGAACTCGCACGTTTTCGCAATTATTCGGCTTTTGAATGTATCAGCTAG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy