Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_2 IGR483 IGR484 IGR485 IGR487 IGR486 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 Type: tandem, Name:  - 9 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 lplA, - CPn0618 lplA, - CPn0618
* Calculated from Protein Sequence

Gene ID: CPn0615

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgsA  

Definition:
phosphatidylglycerophosphate synthase

Gene Start:
708137

Gene Stop:
707631

Gene Length:
507

Molecular Weight*:
19301

pI*:
9.40

Net Charge*:
6.23

EC:
2.7.8.5  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:
PGSA (phosphatidylglycerophosphate synthase, or CDP-diacyglycerol-
glycerol -3-phosphate) is an integral membrane protein involved
in synthesis of acidic phospholipids. CDP-diacylglycerol-glycerol-3-phosphate
is converted to 3-(3-phosphatidyl)-glycerol 1-phosphate.

Blast Summary:  PSI-Blast Search
CPn0615 is orthologous to CT496, a predicted phosphatidylglycerophosphate synthase:
residues 1-167 are 65% similar to CT496. CPn0615 is weakly similar to UU364, MG114, TP0256, and
CT797.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0615 is weakly paralogous to CPn0947, a predicted Glycerol-3-P Phosphatydyltransferase:
residues 26-131 are 29% similar to CPn0947.

Pfam Summary:  Pfam Search
Residues 28 to 161 (E-value = 6.6e-25) place CPn0615 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
23  
40
transmembrane  
63  
80
transmembrane  
85  
102
transmembrane  
118  
135
transmembrane  
140  
157

PDB Hit:


Gene Protein Sequence:
MRQFCNLLSLSRLWLALYFCQEKLHIRLLAIVGAMLSDVLDGYLARRYKA
TSRLGSILDPITDKVFVFVCITVLYMEGSLSIAHLFFICARDLFLIIFVC
YLSLVKGWKGYDYGSLFWGKIFTVVQFIILLGVTAGGEIPWTGLVPLVAL
GFLYFLERIMDYKKQFLR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGACAATTTTGCAACCTACTTTCTCTATCACGTTTGTGGCTAGCGCT
ATACTTCTGCCAAGAAAAATTGCATATCCGCTTACTTGCTATTGTTGGAG
CTATGCTAAGCGATGTCTTAGATGGCTATCTTGCTCGACGCTATAAAGCG
ACAAGTCGTCTCGGTTCAATCCTAGACCCTATTACAGATAAAGTCTTTGT
GTTCGTTTGTATCACGGTCCTCTATATGGAAGGATCCTTATCAATAGCAC
ACCTCTTTTTCATTTGCGCTCGAGACTTATTCCTTATTATCTTTGTCTGC
TACCTTTCTTTAGTTAAAGGTTGGAAAGGCTATGATTATGGCTCTTTATT
TTGGGGCAAGATCTTTACAGTAGTTCAATTTATTATTTTACTAGGGGTCA
CGGCAGGGGGTGAAATTCCTTGGACCGGACTAGTCCCCCTCGTGGCTCTC
GGTTTTCTATATTTCCTCGAGAGAATTATGGATTATAAAAAACAGTTTCT
CCGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy