Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_2 IGR483 IGR484 IGR485 IGR487 IGR486 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 gidA, - CPn0617 Type: tandem, Name:  - 9 pgsA, - CPn0615 sohB, - CPn0613 adt, - CPn0614 polA, - CPn0612 CPn0611 CPn0611 dnaB, - CPn0616 gidA, - CPn0617
* Calculated from Protein Sequence

Gene ID: CPn0614

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adt  

Definition:
ribonucleoside triphosphate translocase (NPT2)

Gene Start:
707402

Gene Stop:
705780

Gene Length:
1623

Molecular Weight*:
60041

pI*:
9.70

Net Charge*:
12.60

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:
See Tjaden et al., J. Bact. 181:1196, 1999.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to putative ATP/ADP translocase sequences. CPn0614
is orthologously related to CT495 and CT065, both predicted riboside triphosphate carrier
proteins. No similarity to T.pallidum or M.genitalium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0477
COG name: Permeases
Functional Class:  G,E,R
The phylogenetic pattern of COG0477 is AMTKYQVCEBRHUJGPo-INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0614 is paralogously related to CPn0351, a predicted translocase.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
44
transmembrane  
65  
82
transmembrane  
98  
115
transmembrane  
143  
160
transmembrane  
225  
242
transmembrane  
292  
310
transmembrane  
337  
354
transmembrane  
367  
384
transmembrane  
390  
407
transmembrane  
466  
490

PDB Hit:


Gene Protein Sequence:
MQSSEVKPFSRLRAYLCPIYKSEFSKFVPLFLLAFFVGFNYCLLKNMKDT
LVIVGSDAGAEVIPFLKVWGIVPGAVIVTMVYGWLGSRYPRDTVFYCFMA
AFLGFFFLFAVIIYPVGDSLHLNSLADKLQELLPQGLRGFIVMVRYWSYS
IYYVMSELWSSVVLSMLFWGLANQITTITEAGRFYALINTGLNLSSICAG
EISYWMGKQTFVAYSFACDSWHSVMLNLTMLITCSGLIMIWLYRRIHHLT
IDTSIPPSRRVLAEEGAATANLKEKKKPKAKARNLFLHLIQSRYLLGLAI
IVLSYNLVIHLFEVVWKDQVSQIYSSHVEFNGYMSRITTLIGVVSVLAAV
LLTGQCIRKWGWTVGALVTPLVMLVSGLLFFGTIFAAKRDISIFGGVLGM
TPLALAAWTGGMQNVLSRGTKFTFFDQTKEMAFIPLSPEDKNHGKAAIDG
VVSRIGKSGGSLIYQGLLVIFSSVAASLNVIALVLLIIMVVWIAVVAYIG
KEYYSRAADAVATLKQPKEPSSSIVREAQESVEQEEMAVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGTCATCAGAAGTGAAACCCTTTTCAAGGCTGCGGGCATATCTTTG
TCCTATTTATAAATCAGAATTTTCTAAGTTTGTTCCACTATTTCTACTAG
CGTTTTTCGTTGGCTTTAACTACTGCCTGCTGAAAAACATGAAAGATACT
CTGGTCATTGTCGGTTCAGATGCTGGGGCAGAAGTGATTCCCTTCCTTAA
GGTTTGGGGAATTGTCCCGGGAGCTGTTATTGTTACTATGGTCTATGGGT
GGTTAGGCAGTCGGTATCCTCGGGATACCGTTTTTTATTGCTTCATGGCC
GCATTCCTTGGTTTTTTCTTCCTGTTTGCTGTGATCATTTATCCTGTAGG
GGATAGCCTGCATCTCAACTCTCTCGCTGATAAATTACAAGAGCTCCTTC
CTCAAGGACTTCGTGGTTTTATTGTGATGGTCCGTTACTGGAGTTACAGT
ATTTATTACGTAATGTCAGAGCTGTGGAGTTCGGTTGTTCTTTCGATGTT
GTTCTGGGGACTAGCCAATCAGATTACTACAATTACTGAAGCGGGCCGTT
TTTACGCTCTTATCAATACAGGATTAAATCTCTCCTCAATATGCGCAGGA
GAAATCTCCTATTGGATGGGGAAACAAACATTTGTTGCCTACTCCTTTGC
ATGTGATTCCTGGCACTCTGTAATGCTCAACTTGACCATGCTGATCACTT
GTTCTGGTTTAATTATGATCTGGCTATATAGGCGGATTCATCATTTGACT
ATTGATACTTCGATCCCTCCATCTAGACGTGTCTTGGCAGAAGAGGGAGC
AGCTACTGCTAATCTAAAGGAAAAGAAAAAACCTAAAGCCAAAGCTAGAA
ACCTTTTCTTACACCTCATTCAGTCTCGTTATTTATTAGGGCTCGCTATT
ATTGTCCTATCCTATAATTTGGTGATCCATCTATTCGAAGTCGTTTGGAA
GGATCAAGTTAGCCAGATTTACAGTTCTCACGTAGAATTCAATGGGTATA
TGAGTAGAATCACTACCCTCATTGGCGTCGTTTCTGTATTAGCAGCTGTA
CTCCTTACCGGACAGTGTATCCGTAAATGGGGATGGACTGTCGGTGCTTT
AGTCACTCCATTGGTAATGTTAGTTTCAGGACTGCTCTTTTTCGGAACTA
TTTTTGCTGCAAAAAGAGACATCTCTATTTTTGGGGGAGTTCTTGGAATG
ACACCTCTGGCTCTAGCTGCCTGGACTGGAGGGATGCAAAATGTCCTATC
CCGGGGGACGAAATTTACGTTCTTTGATCAAACCAAGGAAATGGCCTTTA
TCCCACTTTCTCCAGAGGATAAAAATCATGGGAAAGCCGCGATTGATGGT
GTCGTTTCAAGGATAGGAAAGTCTGGAGGCTCTTTAATTTACCAAGGGCT
GCTTGTTATTTTCTCTTCTGTTGCAGCAAGTTTAAACGTCATCGCCCTAG
TTCTTCTCATTATTATGGTCGTTTGGATTGCGGTTGTTGCCTATATCGGT
AAAGAATACTACTCTAGAGCTGCTGATGCTGTAGCAACCTTGAAACAACC
TAAAGAACCTTCCTCTTCAATCGTACGTGAAGCCCAGGAATCTGTAGAAC
AAGAAGAAATGGCTGTTCTGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy