Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_2 IGR483 IGR484 IGR485 IGR487 IGR486 pgsA, - CPn0615 sohB, - CPn0613 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 pgsA, - CPn0615 sohB, - CPn0613 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 dnaB, - CPn0616 Type: tandem, Name:  - 9 pgsA, - CPn0615 sohB, - CPn0613 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0611 CPn0611 dnaB, - CPn0616
* Calculated from Protein Sequence

Gene ID: CPn0613

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sohB  

Definition:
protein protease IV/endopeptidase IV

Gene Start:
705656

Gene Stop:
704655

Gene Length:
1002

Molecular Weight*:
36356

pI*:
7.70

Net Charge*:
1.93

EC:
3.4.-.-  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Secondary Evidence:
Baird, L., B. Lipinska, S. Raina, C. Georgopoulos. 1991. "Identification of the Escherichia coli sohB gene, a multicopy suppressor of the HtrA (DegP) null phenotype." J.Bacteriol. 173:5763-5770.

Comment:
In E.coli, the SPPA protein digests signal peptides in the
process of protein secretion; it is an integral membrane
protein and a homotetramer. See also SOHB proteins.

SohB appears to be a suppressor of htrA (degP, a periplasmic endoprotease, serine protease in E. coli).

Blast Summary:  PSI-Blast Search
CPn0613 is orthologously related to CT494: residues 1-319 of CPn0613 are 54% similar to residues 13-332 of CT494, a predicted protein protease IV/endopeptidase IV from C. trachomatis.
CPn0613 is slightly similar to TP0997, a predicted protease IV from T. pallidum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class:  N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 126 to 282 (E-value = 7.7e-25) place CPn0613 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
35
transmembrane  
138  
162

PDB Hit:


Gene Protein Sequence:
MKTLWHFVSKAFLSIVGLCCGVVLAFVVIFALIASSLGNGDATFVSLPDA
QGEVKDLGKTAPIIAVIEMKDVIASSKNTAKTIQNILEGFEKAPLKDRVK
GIVIDMDCPGGEVFEIDRIYSMLRFWKERKGFPIYIYVNGLCASGGYYVS
CAATKIYATSSSLIGSIGVRSGPFFNVKEGLNRYGVESDLLTAGKDKAPM
NPYTPWTSHDREERQATLDFLYGQFVDIVTQNRPLLTKEKLVHTLGARIF
SPEKAKQEGYIDVVGATKEQVLQDIVAVCKIEDNYRVIGSGGDGWWKRVA
SAAASSPLVTGMIKHDILPLSHDAAYIPPYLAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACGTTGTGGCACTTCGTATCCAAAGCCTTTTTATCGATAGTAGG
ACTGTGTTGCGGAGTTGTTCTTGCTTTTGTCGTTATATTCGCACTCATAG
CTTCCTCTTTAGGAAATGGGGATGCTACCTTCGTTAGCTTGCCTGACGCC
CAAGGAGAAGTAAAAGATCTAGGGAAAACAGCCCCCATTATTGCTGTTAT
CGAAATGAAAGATGTAATTGCTTCTTCAAAAAATACGGCCAAAACGATTC
AGAATATTTTAGAAGGATTTGAGAAAGCTCCTCTTAAAGATCGTGTCAAA
GGTATTGTCATTGATATGGATTGCCCAGGAGGCGAGGTCTTTGAAATAGA
TAGAATTTACTCTATGCTTCGCTTTTGGAAAGAACGTAAGGGATTCCCTA
TTTATATTTATGTGAATGGTCTTTGTGCTTCGGGAGGCTATTATGTATCC
TGCGCTGCAACTAAAATTTATGCCACCTCCTCCTCTCTTATCGGTTCTAT
CGGAGTGCGTTCTGGACCATTCTTCAATGTAAAAGAAGGTTTAAATCGCT
ACGGAGTTGAAAGTGATCTGCTGACAGCTGGAAAAGATAAGGCTCCAATG
AATCCTTATACACCGTGGACTTCTCATGATAGAGAAGAACGGCAAGCGAC
TCTTGATTTTCTCTACGGACAATTTGTTGATATAGTTACACAAAACCGTC
CTCTGCTTACTAAAGAGAAGTTAGTTCACACTCTCGGAGCACGTATTTTT
TCTCCAGAGAAGGCCAAACAAGAAGGCTATATTGATGTTGTAGGCGCAAC
TAAAGAACAAGTCCTTCAAGACATAGTTGCTGTTTGTAAGATTGAAGATA
ACTATAGAGTGATTGGCTCTGGTGGTGATGGTTGGTGGAAGCGGGTGGCT
TCAGCTGCAGCTTCAAGTCCATTAGTTACTGGCATGATTAAACACGATAT
TCTGCCTTTATCCCATGACGCTGCATACATACCTCCCTACTTGGCACTGT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy