Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR483 IGR482 IGR481 IGR480 IGR484 IGR485 IGR486 pgsA, - CPn0615 pyr5, - CPn0608 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0609 pgsA, - CPn0615 pyr5, - CPn0608 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0609 Type: tandem, Name:  - 9 pgsA, - CPn0615 pyr5, - CPn0608 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0611 CPn0611 CPn0609
* Calculated from Protein Sequence

Gene ID: CPn0612

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
polA  

Definition:
DNA polymerase I

Gene Start:
704631

Gene Stop:
702019

Gene Length:
2613

Molecular Weight*:
97710

pI*:
5.60

Net Charge*:
-15.83

EC:
 2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
Pol I is both a DNA-dependent polymerase and an
exonucleae (3' to 5' and 5' to 3'). In Bacillus,
it is a monomer.

From Prosite PDOC00412:

Replicative DNA polymerases (EC 2.7.7.7) are the
key enzymes catalyzing the accurate replication
of DNA. They require either a small RNA molecule
or a protein as a primer for the de novo
synthesis of a DNA chain.

Blast Summary:  PSI-Blast Search
CPn0612 is similar to TP0105 in T. pallidum, MG262 in M. genitalium and UU414 in U. urealyticum. They are all predicted DNA polymerase I.

CPn0612 is orthologously related to CT493 and they
share 60% similarity.


COGS Summary:  COGS Search
BeTs to 10 clades of COG0749
COG name: DNA polymerase I - 3'-5' exonuclease and polymerase domains
Functional Class:  L
The phylogenetic pattern of COG0749 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 166 (E-value = 6.8e-90) place CPn0612 in the 5_3_exonuc_N family which is described as 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739)
Residues 168 to 269 (E-value = 1.6e-52) place CPn0612 in the 5_3_exonuc family which is described as 5'-3' exonuclease, C-terminal SAM fold (PF01367)
Residues 494 to 870 (E-value = 3.4e-130) place CPn0612 in the DNA_pol_A family which is described as DNA polymerase family A (PF00476)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
188  
255
non-globular  
450  
543

PDB Hit:


Gene Protein Sequence:
MKKLFVLDASGFIFRAYFALPEMKNHQGQATQAVFGFIRSLNKLIKEFSP
EYMISVFDGPNNKQSRQAIYADYKSNRQKKFEDIPPQIALVKEYCSLIGL
AYLEKESVEADDVIASIAKKAREENYKVYVCTADKDLLQLVNDHVVAWNP
WADQGVVGISEVIERYGIPPGNIPDYLALVGDSSDNIPGLPGCGPKKAAA
LLKQFGSVEGLLENLDAVKGLSQTMLSERQETLKLSKRLALLDSNIPIPV
PIESLTFPQHPVDEEKLIHFYIQQGFKTLVPSKQTEAATVDVQIIKDAES
LTNILNLVQGGDIAFAVAYTGNHLLSLKLEGLALTQGSGVFFIALEEEGT
KILPILKDFFLREDLTFYGYNLKRDCHALLNAGIVIREISYDLALAEHLT
NGGGKISFQSLLVNHGFTETAHRFAKEWGNSGLPIGRLPEQPEQYFGEFV
AYLPIIKDAILEEINRKNLNHILSDIEMPLEKVLFSMERAGVPLDVEELA
ILEALFETELAVLTEEIYDLSGRPFNIKSPKQLSDILYNELGLRPIDKAK
STRAEVLEALRSEHPIIEKLLAFRTIEKLLSTYVKALPKQVDSHTQRIHP
SFDQTGAVTGRLACRDPNLQNIPIRSERGILLRKAFRLSEKNSYFLSADY
SQIELRFLAHLSQDKSLKFAFESGEDIHAFTASQVFHVPLEQVSKEQRMQ
AKTVNFGIVYGQQAFGLAKVLKISIGEAQELIQAYFSRYPEIAHFVEETI
QQAAKDLRVTTMLGRERIIDSWNEFPGSRAASGRFAVNTRIQGSAAELIK
LAMLDISQAIKQQQMKSRMLLQIHDELLFEVPEEEIEEMQRLVREKMESA
MTLSVPIVVNILIGKNWAEC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAACTGTTTGTATTAGATGCCTCAGGATTTATCTTTCGTGCCTA
CTTTGCTTTGCCAGAAATGAAAAATCATCAAGGACAAGCAACACAAGCAG
TTTTTGGATTTATTCGTTCTTTAAATAAACTTATCAAAGAATTCTCTCCA
GAATACATGATCTCCGTCTTTGACGGTCCTAATAATAAACAAAGCCGTCA
GGCGATTTATGCTGATTACAAAAGTAATCGACAGAAAAAATTCGAAGACA
TCCCTCCACAAATAGCTCTAGTTAAAGAGTACTGCTCTTTAATAGGCCTA
GCTTACTTAGAAAAAGAGTCGGTAGAAGCTGACGATGTGATTGCAAGTAT
TGCTAAGAAGGCTAGAGAAGAGAATTATAAAGTTTACGTATGCACCGCGG
ATAAAGATCTGTTGCAGCTTGTAAACGATCATGTTGTAGCTTGGAATCCT
TGGGCAGATCAAGGTGTTGTAGGGATCTCTGAGGTGATAGAACGTTATGG
GATTCCTCCAGGGAATATCCCTGATTATCTAGCGTTAGTTGGAGACTCTT
CTGATAACATTCCAGGGCTCCCAGGTTGTGGGCCTAAAAAAGCTGCAGCA
CTTCTTAAACAATTTGGAAGTGTTGAGGGACTTTTAGAAAATTTAGACGC
CGTGAAGGGATTAAGTCAAACTATGCTGAGTGAACGGCAGGAGACTTTAA
AGCTTAGTAAACGGCTTGCCCTCTTGGATTCTAATATCCCTATCCCAGTA
CCAATAGAGTCCCTTACCTTTCCACAACACCCTGTGGATGAAGAGAAACT
CATACACTTTTATATACAACAAGGATTTAAAACTCTTGTGCCGTCCAAGC
AAACAGAGGCTGCGACAGTCGATGTTCAGATAATCAAAGATGCGGAAAGC
CTCACCAACATTTTAAACCTTGTGCAAGGGGGGGACATTGCCTTTGCTGT
AGCATATACAGGAAACCATCTTCTCTCTTTGAAGCTTGAAGGTTTAGCTT
TGACACAGGGATCAGGGGTATTTTTTATTGCCTTAGAAGAGGAAGGCACG
AAGATACTCCCTATATTAAAAGATTTCTTTTTAAGAGAAGATCTTACTTT
CTATGGTTATAATCTAAAACGCGATTGCCACGCTCTTCTAAATGCAGGAA
TTGTAATTCGAGAAATTTCTTATGACCTAGCTTTAGCTGAGCACTTGACA
AATGGGGGAGGAAAAATCTCCTTTCAATCTCTTTTAGTAAATCACGGATT
TACAGAAACTGCTCACCGGTTTGCTAAGGAATGGGGAAATTCAGGATTGC
CTATAGGTCGTCTACCAGAACAACCTGAGCAATATTTTGGTGAATTTGTT
GCCTACCTTCCCATAATAAAAGACGCTATTTTAGAAGAAATCAACCGTAA
GAATCTCAACCATATCTTAAGTGATATTGAAATGCCCTTGGAGAAGGTTC
TTTTCTCTATGGAAAGAGCTGGAGTGCCTTTAGATGTTGAGGAGTTGGCT
ATTTTAGAAGCCCTCTTTGAAACAGAATTAGCCGTACTGACAGAGGAAAT
CTATGATCTTTCTGGAAGGCCATTCAATATAAAATCACCAAAACAGTTAT
CAGATATTTTATATAACGAATTAGGTCTTCGCCCTATAGATAAGGCAAAA
TCTACACGTGCAGAGGTGTTAGAGGCTTTACGTAGTGAGCACCCAATTAT
CGAAAAACTTTTAGCTTTCCGGACGATTGAAAAATTATTATCCACATATG
TAAAAGCATTACCGAAACAAGTAGATTCCCATACACAGAGAATACACCCC
TCTTTTGATCAGACAGGAGCTGTGACAGGAAGATTAGCTTGTCGAGATCC
TAATTTACAAAATATTCCTATAAGATCGGAACGAGGAATCTTACTTAGGA
AGGCTTTTCGTTTATCTGAGAAAAATAGTTATTTTTTATCTGCCGATTAT
TCTCAAATTGAGTTAAGATTTTTAGCACATTTAAGCCAAGATAAGTCATT
AAAATTTGCTTTTGAGTCAGGAGAAGATATTCATGCTTTTACTGCATCAC
AAGTGTTTCATGTGCCTTTAGAACAGGTTTCAAAAGAACAAAGAATGCAG
GCAAAGACAGTAAATTTTGGTATCGTGTATGGACAACAGGCTTTTGGTTT
GGCAAAAGTTTTAAAAATTTCTATTGGCGAAGCTCAAGAGTTAATTCAAG
CATATTTCTCTCGTTATCCCGAAATTGCTCATTTTGTTGAAGAAACTATA
CAACAAGCAGCTAAAGATTTACGGGTGACCACGATGTTAGGTCGAGAAAG
AATTATCGATAGTTGGAATGAATTTCCTGGCTCAAGAGCAGCTTCAGGAC
GTTTTGCTGTAAATACTCGCATTCAGGGAAGTGCTGCTGAATTGATAAAA
CTTGCAATGCTAGATATTTCACAAGCAATAAAGCAACAGCAAATGAAGAG
TCGTATGTTATTACAAATACATGACGAATTATTATTTGAGGTTCCTGAAG
AAGAAATAGAAGAGATGCAAAGACTAGTGAGAGAGAAGATGGAATCAGCT
ATGACTTTATCCGTTCCTATAGTTGTGAATATCTTAATTGGAAAAAATTG
GGCAGAATGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy