Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR483 IGR482 IGR481 IGR480 IGR484 IGR479 pyr5, - CPn0608 CPn0606 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0609 pyr5, - CPn0608 CPn0606 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0609 Type: tandem, Name:  - 9 pyr5, - CPn0608 CPn0606 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 adt, - CPn0614 polA, - CPn0612 CPn0611 CPn0611 CPn0609
* Calculated from Protein Sequence

Gene ID: CPn0611

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (ATPase or kinase)

Gene Start:
702025

Gene Stop:
701417

Gene Length:
609

Molecular Weight*:
22898

pI*:
5.20

Net Charge*:
-6.69

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible ATPase or kinase (yacE).

Blast Summary:  PSI-Blast Search
CPn0611 is orthologously related to CT492: residues 1-202 of CPn0611 are 60% similar to residues 1-202 of CT492, a predicted conserved hypothetical protein (ATPase or kinase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0237
COG name: Predicted ATPase
Functional Class:  R
The phylogenetic pattern of COG0237 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 186 (E-value = 3.1e-22) place CPn0611 in the CoaE family which is described as Dephospho-CoA kinase (PF01121)

PDB Hit:


Gene Protein Sequence:
MLKLLKVSITGDLSSGKTEACQVFQELGAYVVSADEISHSFLIPHTRIGR
RVIDLLGSDVVVDGAFDAQAIAAKVFYNSVLLQGLEAILHPEVCRIIEEQ
YHQSIQDGNYPLFVAEVPLLYEIHYAKWFDSVILVMANEDIRRERFMKKT
GRSSEDFDQRCSRFLNVEEKLAQADVVVENNGTKKELHQKIEEYFYALKG
AL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAATTATTAAAAGTTTCCATTACAGGGGATCTCTCTTCTGGGAA
GACTGAAGCTTGCCAAGTTTTTCAGGAATTGGGAGCCTATGTAGTTAGTG
CTGATGAAATTTCGCATAGTTTCCTTATCCCTCATACACGCATAGGTCGT
CGTGTTATAGATCTTTTAGGATCGGATGTTGTAGTTGATGGGGCGTTTGA
TGCGCAAGCCATAGCAGCCAAAGTTTTTTACAATTCCGTTCTATTACAAG
GTCTGGAAGCCATTCTACATCCAGAAGTTTGTCGAATTATTGAGGAACAA
TATCATCAAAGTATTCAAGATGGGAACTATCCGTTATTTGTCGCAGAAGT
GCCTTTATTATACGAAATACACTATGCTAAGTGGTTTGATTCAGTGATCC
TTGTTATGGCAAACGAAGATATTCGACGCGAGAGATTCATGAAGAAAACA
GGGCGTTCCTCTGAAGACTTTGATCAAAGGTGTTCGCGTTTTCTAAATGT
CGAAGAAAAGTTAGCACAAGCAGATGTTGTTGTTGAAAACAACGGAACTA
AAAAAGAATTACATCAAAAAATTGAAGAATATTTTTACGCTTTAAAGGGA
GCATTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy