Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR483 IGR482 IGR481 IGR480 IGR484 IGR479 IGR478 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 Type: tandem, Name:  - 9 pyr5, - CPn0608 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0605 CPn0611 CPn0611 CPn0606 CPn0605 CPn0609
* Calculated from Protein Sequence

Gene ID: CPn0610

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rho  

Definition:
transcription termination factor rho

Gene Start:
701420

Gene Stop:
700026

Gene Length:
1395

Molecular Weight*:
51808

pI*:
7.30

Net Charge*:
1.13

EC:
 

Functional Class:
transcription; transcription factors  

Pathway: pathway table

Comment:
Transcription termination factor rho facilitates transcription
termination by a mechanism that involves rho binding to the
nascent RNA, activation of rho's RNA-dependent ATPase activity,
and release of the mRNA from the DNA template.
Rho is part of a homohexamer.

Blast Summary:  PSI-Blast Search
CPn0610 is orthologously related to CT491: residues 1-464 of CPn0610 are similar to residues 1-464 of CT491, transcription termination factor rho from C. trachomatis.
CPn0610 is also similar to TP0254, TP0402.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1158
COG name: Transcription termination factor rho
Functional Class:  K
The phylogenetic pattern of COG1158 is -----qv-ebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 247 to 417 (E-value = 1.5e-41) place CPn0610 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

PDB Hit:


Gene Protein Sequence:
MKEERSSEILPRVKETKKHAYVSMQEKSCVGECAVVASESEEAESVTVTK
IAKLQRMGIEELNILARQYGVKNIGSLTKSQVVFEIVKAKSERPDELLIG
EGVLEVLPDGFGFLRSPTYNYLPSAEDIYVSPAQIRRFDLKKGDTIIGTI
RSPKEKEKYFALLKVDKINGSTPDKAKERVLFENLTPLYPNQRIVMEMGK
DHLAERVLDLTAPIGKGQRGLIVAPPRSGKTVILQSIAHAIAVNNPDIVL
IVLLIDERPEEVTDMIRQVRGEVVASTFDEQPERHIQVAEMVIEKARRLV
EHGNDVVILLDSITRLARAYNTVQPHSGKILTGGVDASALHKPKRFFGAA
RNIEGGGSLTILATALIDTGSRMDEVIFEEFKGTGNMELVLDRRLSDRRT
YPAIDLIKSGTRKEELLYHPSELERVYLFRQAIADLTTIDAMHLLLGRLK
KTNSNAEFLLSLKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAAGAGCGTTCTTCAGAAATCTTGCCTAGGGTGAAGGAAACGAA
AAAACATGCTTACGTTTCTATGCAGGAAAAATCTTGTGTAGGGGAGTGTG
CTGTAGTTGCCAGTGAGTCTGAAGAGGCCGAGTCTGTCACAGTTACAAAA
ATTGCTAAACTGCAAAGAATGGGAATTGAAGAGCTGAATATATTAGCTCG
CCAATACGGTGTGAAAAATATAGGATCTCTAACAAAGTCTCAGGTCGTCT
TTGAGATTGTTAAAGCCAAGTCAGAGCGCCCAGATGAATTGCTGATAGGT
GAAGGCGTGTTAGAAGTCCTTCCAGACGGATTTGGATTTCTGAGATCCCC
AACCTATAATTACCTACCTTCTGCTGAAGATATTTATGTTTCTCCAGCTC
AGATTCGTAGATTTGATCTCAAAAAAGGTGATACGATTATCGGTACGATA
CGCTCACCTAAAGAGAAAGAAAAGTACTTTGCTCTATTGAAAGTAGATAA
GATCAACGGATCTACTCCAGATAAAGCTAAAGAACGTGTACTTTTTGAAA
ACCTGACCCCCCTCTACCCTAATCAAAGAATCGTGATGGAAATGGGGAAA
GATCATTTGGCTGAGAGAGTCTTAGATCTTACCGCCCCCATTGGAAAAGG
ACAGCGGGGATTGATTGTAGCCCCACCAAGATCTGGGAAAACTGTCATTC
TCCAAAGCATAGCACACGCGATTGCTGTGAATAATCCTGATATTGTTCTT
ATTGTCTTGTTAATTGACGAAAGACCCGAAGAAGTTACCGATATGATTCG
GCAAGTTCGTGGAGAAGTTGTTGCCTCGACATTTGACGAACAACCAGAAA
GGCATATTCAGGTCGCTGAGATGGTTATAGAGAAAGCTCGTCGTTTAGTG
GAACATGGAAATGATGTGGTCATTCTACTCGATTCCATAACACGATTAGC
ACGTGCCTATAATACAGTTCAGCCGCATTCTGGAAAAATTCTTACCGGGG
GTGTCGATGCTAGTGCATTGCACAAACCTAAGCGTTTCTTCGGTGCTGCA
AGAAATATTGAAGGCGGGGGATCGCTCACAATTCTTGCAACCGCTTTAAT
TGATACTGGTTCCAGAATGGACGAAGTGATTTTTGAAGAATTCAAAGGCA
CTGGAAATATGGAACTCGTCTTGGATCGACGTCTGTCAGATCGAAGAACC
TACCCCGCTATTGATTTAATTAAGAGTGGAACTAGAAAAGAAGAACTCCT
CTATCATCCTAGTGAATTAGAAAGGGTCTACCTTTTCCGTCAGGCCATAG
CAGATCTTACTACTATAGACGCCATGCATCTCTTGCTAGGAAGGTTGAAG
AAAACCAATAGTAACGCAGAATTCTTGTTGTCACTCAAAGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy