Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR483 IGR482 IGR481 IGR480 IGR479 IGR478 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 Type: tandem, Name:  - 9 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 sohB, - CPn0613 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0605 CPn0611 CPn0611 CPn0605 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0609

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
699705

Gene Stop:
699989

Gene Length:
285

Molecular Weight*:
10699

pI*:
5.00

Net Charge*:
-1.82

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits. CPn0609 shows some similarity with CT490: residues 1-86 of CPn0609 are 37% similar to residues 1-83 of CT490 (score 50, e-value: 2e-08).

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLIRLFLGISLPKGFPLYLEPPLVLATFQGTQFVGTYSEATNPLYIDNLN
LNYHYTQELLYKAVPCNYKSIYREIPLIIFPEVLIGSTPTQSTE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAATACGCCTGTTTCTTGGAATTTCTCTTCCCAAAGGCTTTCCCTT
ATATTTGGAGCCTCCTCTAGTTCTTGCAACGTTTCAAGGAACTCAATTCG
TGGGAACTTATAGTGAGGCTACAAACCCTTTGTATATCGATAATTTGAAT
CTAAATTACCACTATACTCAAGAACTACTTTATAAAGCAGTCCCGTGTAA
TTATAAATCTATATATAGAGAGATACCTTTAATTATTTTCCCAGAAGTAC
TCATAGGAAGCACGCCAACACAATCTACTGAGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy