Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR482 IGR481 IGR480 IGR479 IGR478 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 Type: tandem, Name:  - 9 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0605 CPn0611 CPn0611 CPn0605 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0608

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyr5  

Definition:
uridine 5'-monophosphate synthase

Gene Start:
699645

Gene Stop:
699013

Gene Length:
633

Molecular Weight*:
22880

pI*:
7.10

Net Charge*:
0.10

EC:
 

Functional Class:
purines, pyrimidines, nucleosides and nucleotides  

Pathway: pathway table

Comment:
Note similarity to Orotate phosphoribosyltransferase sequences which are associated with EC 2.4.2.10.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Uridine 5'-Monophosphate Synthase sequences. Numerous lesser (thought still signficicant) hits to OROTATE PHOSPHORIBOSYLTRANSFERASE sequences. E.g. residues 17-191 are 43% similar to PYR5_ARATH; residues 20-204 are 39% similar to PYR5_TOBAC; and residues 9-193 are 40% similar to PYR5_BOVIN.
BLAST reveals no significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.ureaplasma.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0461
COG name: Orotate phosphoribosyltransferase
Functional Class: F
The phylogenetic pattern of COG0461 is amtkYqvcebrhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 17-102 are 48% similar to a defined domain of PYR5_ARATH.

Residues 111-174 are 45% similar to a defined domain of PYR5_HUMAN.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 41 to 173 (E-value = 2.5e-16) place CPn0608 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:


Gene Protein Sequence:
MMNYEDAKLRGQAVAILYQIGAIKFGKHILASGEETPLYVDMRLVISSPE
VLQTVATLIWRLRPSFNSSLLCGVPYTALTLATSISLKYNIPMVLRRKEL
QNVDPSDAIKVEGLFTPGQTCLVINDMVSSGKSIIETAVALEENGLVVRE
ALVFLDRRKEACQPLGPQGIKVSSVFTVPTLIKALIAYGKLSSGDLTLAN
KISEILEIES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAACTACGAAGATGCAAAATTACGCGGTCAAGCTGTAGCAATTCT
ATACCAAATCGGAGCTATAAAGTTCGGAAAACATATTCTCGCTAGCGGAG
AAGAAACTCCTCTGTATGTAGATATGCGTCTTGTGATCTCCTCTCCAGAA
GTTCTCCAGACAGTGGCAACTCTTATTTGGCGCCTCCGCCCCTCATTCAA
TAGTAGCTTACTCTGCGGAGTCCCTTATACTGCTCTAACCCTAGCAACCT
CGATCTCTTTAAAATATAACATCCCTATGGTATTGCGAAGGAAGGAATTA
CAGAATGTAGACCCCTCGGACGCTATTAAAGTAGAAGGGTTATTTACTCC
AGGACAAACTTGTTTAGTCATCAATGATATGGTTTCCTCAGGAAAATCTA
TAATAGAGACAGCAGTCGCACTGGAAGAAAATGGTCTGGTAGTTCGTGAA
GCATTGGTATTCTTAGATCGTAGAAAAGAAGCGTGTCAACCACTTGGTCC
ACAGGGAATAAAAGTCAGTTCGGTATTTACTGTACCCACTCTGATAAAAG
CTTTGATCGCTTATGGGAAGCTAAGCAGTGGTGATCTAACCCTGGCAAAC
AAAATTTCCGAAATTCTAGAAATTGAATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy