Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR482 IGR481 IGR476 IGR480 IGR479 IGR478 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0605 CPn0611 CPn0611 CPn0605 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0607

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgC  

Definition:
ADP-glucose pyrophosphorylase

Gene Start:
698895

Gene Stop:
697570

Gene Length:
1326

Molecular Weight*:
50016

pI*:
6.30

Net Charge*:
-5.27

EC:
2.7.7.27  

Functional Class:
energy metabolism; sugars  

Pathway: pathway table
Starch and sucrose metabolism

Comment:
This protein is typically seen in plants where it contributes to starch formation by converting alpha-D-glucose-1-phosphate to ADP-glucose.

From Prosite PDOC00638:

ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) (EC 2.7.7.27) catalyzes a very important step in the biosynthesis of alpha 1,4-glucans (glycogen or starch) in bacteria and plants: synthesis of the activated glucosyl donor, ADP-glucose, from glucose-1-phosphate and ATP.

ADP-glucose pyrophosphorylase is a tetrameric allosterically regulated enzyme. It is a homotetramer in bacteria while in plant chloroplasts and amyloplasts, it is a heterotetramer of two different, yet evolutionary related, subunits.


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Glucose-1-P Adenyltransferase sequences; e.g. residues 21-440 are 34% similar to GLGC_SYNY3; residues 21-440 are 35% similar to GLGC_ANASP; residues 25-440 are 35% similar to GLGS_SOLTU; and residues 25-429 are 35% similar to GLGS_ORYSA.
CPn0607 is orthologously related to CT489, a predicted ADP-glucose pyrophosphorylase.
Residues 8-441 are 70% similar to CT489. No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0448
COG name: ADP-glucose pyrophosphorylase
Functional Class:  G
The phylogenetic pattern of COG0448 is ------VceBrh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 24-413 span nine regions of similarity to blocks BL00808A,B,D-J (ADP-glucose pyrophosphorylase proteins) with a combined E-value of 2.1e-62.

ProDom Summary:  Protein Domain Search
Residues 21-171 are 41% similar to a defined domain of GLGC_ANASP, defined as: ADP-GLUCOSE PYROPHOSPHORYLASE TRANSFERASE NUCLEOTIDYLTRANSFERASE GLYCOGEN BIOSYNTHESIS GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SYNTHASE SYNTHETASE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 23 to 293 (E-value = 1e-42) place CPn0607 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
60  
78

PDB Hit:


Gene Protein Sequence:
MIENDFPEASNFESSHFYRDKVGVIILCGGEGKRLSPLTNCRCKPTVSFG
GRYKLIDIPISHAISAGFSKIFVIGQYLTYTLQQHLFKTYFYHGVLQDQI
HLLAPEARQGDQIWYQGTADAIRKNLLYFEDTEIEYFLILSGDQLYNMDF
RSIVDTAIRTHVDMVLVAQPIPEKDAYRMGVLDIDSEGKLIDFYEKPQEK
EVLKRFQLSSEDRRIHKLTEDSGDFLGSMGIYLFRRDSLFSLLREEEGND
FGKHLIQAQMKRGQVQTLLYNGYWADIGTIESYYEANIALTQKPHAEKRG
LNCYDDNGMIYSKNHHLPGAIITDSMISSSLLCEGCVINTSHVSRSVLGI
RSKIGENSVVDQSIIMGNARYGSPSMPSLGIGKDCEIRKAIIDENCCIGN
GVKLQNLKGYIKYDSPDKKLFVRDNIIIVPQGTHIPDNYIF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGAAAACGATTTTCCGGAGGCCTCAAATTTTGAGAGCTCTCATTT
TTATCGAGATAAGGTTGGAGTAATTATCTTGTGTGGAGGGGAGGGCAAAA
GGTTATCTCCTCTAACTAATTGTCGCTGTAAGCCTACCGTATCTTTTGGA
GGACGGTATAAGCTGATCGATATTCCAATATCTCATGCAATTAGTGCAGG
TTTTTCAAAAATTTTTGTTATAGGTCAGTACCTTACCTACACTCTACAAC
AGCATTTATTTAAGACGTATTTTTATCATGGAGTTTTGCAGGATCAGATA
CATCTTCTTGCTCCTGAAGCACGTCAGGGTGACCAAATCTGGTATCAGGG
TACCGCAGATGCAATTCGAAAAAACTTACTTTATTTCGAAGATACAGAAA
TCGAATACTTTTTAATCTTATCAGGAGACCAGCTCTACAATATGGATTTT
AGATCTATTGTAGATACAGCCATACGAACTCATGTAGATATGGTTCTTGT
TGCCCAGCCTATCCCAGAAAAAGATGCCTATAGAATGGGAGTCTTAGATA
TTGATTCTGAAGGAAAACTCATCGATTTCTATGAAAAACCTCAAGAAAAA
GAAGTACTCAAGCGTTTTCAGCTTTCTTCTGAAGATCGCCGTATTCATAA
GTTAACCGAAGATTCAGGAGACTTTCTTGGATCAATGGGCATCTACTTAT
TCCGAAGAGACAGTTTGTTTTCTTTGCTTCGCGAAGAAGAAGGAAACGAT
TTTGGAAAGCATCTCATCCAAGCTCAGATGAAGCGGGGACAAGTACAAAC
TCTCCTTTATAATGGGTATTGGGCCGACATCGGAACTATAGAATCTTATT
ATGAAGCAAATATAGCGTTAACTCAAAAGCCTCATGCAGAGAAAAGAGGA
CTGAATTGTTATGATGATAACGGAATGATCTATAGTAAAAATCATCATCT
TCCTGGAGCAATCATTACGGATTCTATGATCTCAAGTTCTTTATTATGTG
AGGGTTGTGTTATTAATACGAGTCATGTATCTCGGAGTGTCTTAGGGATT
CGTAGTAAGATTGGAGAGAACTCTGTAGTCGATCAGTCTATAATTATGGG
CAATGCTCGGTACGGATCTCCATCCATGCCATCTTTAGGAATTGGGAAAG
ACTGTGAGATTCGTAAAGCGATTATAGATGAGAATTGTTGTATTGGAAAC
GGTGTCAAACTACAGAATCTCAAGGGCTATATTAAATATGATTCTCCTGA
TAAAAAGCTATTTGTGAGAGATAATATTATCATTGTTCCTCAAGGCACGC
ACATTCCTGACAACTATATCTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy