Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR482 IGR475 IGR481 IGR476 IGR480 IGR479 IGR478 IGR474 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 polA, - CPn0612 CPn0609 hemZ, - CPn0603 CPn0600 pyr5, - CPn0608 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 CPn0605 CPn0611 CPn0606 polA, - CPn0612 CPn0601 CPn0605 CPn0611 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0606

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
697444

Gene Stop:
696704

Gene Length:
741

Molecular Weight*:
27604

pI*:
5.90

Net Charge*:
-6.49

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0606 is orthologously related to CT488: residues 1-245 of CPn0606 are 64% similar to residues 1-243 of CT488, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.
No hits to M. genitalium, T. pallidum or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1768
COG name: Predicted phosphohydrolases
Functional Class:  R
The phylogenetic pattern of COG1768 is -m---q------------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 215 (E-value = 7.5e-17) place CPn0606 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

PDB Hit:


Gene Protein Sequence:
MHIYGLADLHLALGVPEKTMEVFGDPWIGYHQKICSEWQAVVHPEDIVLL
PGDISWAMNLSEAHKDFAFIGDLPGTKYMIRGNHDYWSSASTSKILQALP
PSLYYLNQGFALLTPHLAVVGVRLWDSPTICVKKENFLTPSTQEQSYTEQ
DEKIFLRELGRLKRAFAALPKEVTEVIVMTHYPPISSDGTPGPISEFLEA
DGRVSLCLFGHIHKVQRPIDGFGNIRGIHYILVAADYVNFVPQEVM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATATTTATGGTTTGGCAGATTTGCATCTAGCCTTAGGCGTCCCTGA
AAAAACTATGGAAGTTTTTGGAGACCCCTGGATAGGATACCATCAGAAAA
TTTGCTCTGAATGGCAAGCTGTTGTCCATCCAGAGGATATTGTTCTCCTC
CCAGGAGATATTTCTTGGGCTATGAACCTCTCAGAGGCTCATAAAGATTT
CGCCTTTATTGGGGATCTCCCAGGAACGAAGTATATGATTCGTGGAAATC
ATGATTACTGGAGTTCTGCTTCAACAAGTAAAATTCTACAAGCACTTCCT
CCCTCTCTATACTATTTGAATCAAGGGTTTGCTCTGTTAACACCCCATCT
TGCTGTTGTAGGAGTGCGACTGTGGGATAGTCCTACAATATGTGTGAAGA
AGGAGAATTTCCTTACTCCTTCTACTCAGGAACAATCTTATACAGAACAG
GATGAAAAGATTTTTCTCCGAGAGTTGGGCCGTTTAAAGAGAGCTTTTGC
TGCCCTTCCTAAAGAAGTCACTGAGGTGATTGTGATGACACACTACCCCC
CAATCAGCAGTGACGGTACTCCAGGACCTATTTCGGAATTCTTAGAAGCT
GATGGAAGAGTCTCTCTATGCCTATTTGGTCATATTCATAAAGTGCAACG
CCCTATAGATGGATTCGGTAATATCCGAGGGATCCACTACATACTAGTGG
CTGCTGATTACGTAAACTTTGTTCCTCAAGAGGTGATGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy