Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR482 IGR475 IGR481 IGR476 IGR480 IGR479 IGR478 IGR474 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0609 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0609 hemZ, - CPn0603 CPn0601 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0605 CPn0611 CPn0605 CPn0611 CPn0600 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0605

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable YhhF-related methylase

Gene Start:
696707

Gene Stop:
696147

Gene Length:
561

Molecular Weight*:
20666

pI*:
7.80

Net Charge*:
1.29

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
Possible member of YhhF family (yhhF).

Blast Summary:  PSI-Blast Search
CPn0605 is orthologously related to CT487: residues 1-185 of CPn0605 are 58% similar to residues 1-185 of CT487, a predicted YhhF-related methylase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0742
COG name: N6-adenine-specific methylase
Functional Class:  L
The phylogenetic pattern of COG0742 is ------vcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 181 (E-value = 1.6e-86) place CPn0605 in the Cons_hypoth95 family which is described as Conserved hypothetical protein 95 (PF03602)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
50  
74

PDB Hit:


Gene Protein Sequence:
VRILAGKYKGKSLKTFSNPHIRPTSGLVKEAFFSICREDIEGAAFLDLFA
GMGAIGFEALSRGAASVVFVDISIKAIQLIHTNSALLGEQLPVVIFRQDA
QSAIQRLIKQKRSFDLIYIDPPYELCNCYVETLLQKIVSGNILNPEGTLF
LENASDEEIACEGLTLRRRRKLGKTYLAEYIVEKDP$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGAATTTTAGCAGGTAAGTACAAAGGGAAATCCTTAAAAACATTTTC
TAATCCACATATCCGACCTACTTCAGGTTTAGTGAAAGAAGCGTTTTTCA
GTATCTGTAGGGAAGATATAGAAGGGGCTGCTTTTTTAGATCTTTTTGCC
GGGATGGGAGCGATAGGTTTTGAAGCCCTAAGTCGTGGAGCTGCTTCTGT
CGTATTCGTGGACATCTCTATAAAAGCAATACAATTAATACACACAAATA
GTGCTTTACTCGGAGAACAACTTCCTGTCGTCATCTTTAGACAAGATGCT
CAATCGGCAATTCAAAGACTTATCAAACAAAAGAGATCCTTTGATCTAAT
CTATATAGATCCTCCTTACGAACTTTGTAATTGTTACGTAGAAACCCTTT
TACAGAAGATTGTTTCGGGAAACATCCTGAATCCTGAAGGGACTCTATTC
CTAGAGAATGCCTCCGATGAAGAGATTGCTTGTGAAGGTTTGACCCTAAG
GCGAAGAAGAAAACTTGGGAAAACATATCTTGCTGAGTATATTGTGGAAA
AGGACCCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy