Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR482 IGR475 IGR481 IGR476 IGR480 IGR479 IGR478 IGR474 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0609 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0609 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 rho, - CPn0610 oppA_5,dppA, - CPn0599 CPn0605 CPn0605 CPn0609 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0604

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fliY  

Definition:
probable periplasmic glutamine transport protein

Gene Start:
695945

Gene Stop:
695193

Gene Length:
753

Molecular Weight*:
27997

pI*:
7.90

Net Charge*:
1.58

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Glutamine Binding Protein sequences; e.g. residues 1-250 are 70% similar to CT486, a predicted periplasmic glutamine tansport protein; residues 13-247 are 25% similar to (U73111) high-affinity periplasmic glutamine binding protein [Salmonella typhimurium]; residues 13-247 are 25% similar to GLNH_ECOLI; and residues 13-247 are 23% similar to (AE001090) glutamine ABC transporter, periplasmic glutamine-binding protein (glnH) [Archaeoglobus fulgidus].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0834
COG name: Periplasmic amino acid binding proteins
Functional Class:  E
The phylogenetic pattern of COG0834 is A-----VCEBrHUJ---LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 13-247 are 25% similar to a defined domain of P74886_SALTY, defined as: RECEPTOR GLUTAMATE PRECURSOR PROTEIN SIGNAL MEMBRANE TRANSPORT SUBUNIT PERIPLASMIC IONIC.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 32 to 250 (E-value = 1e-09) place CPn0604 in the SBP_bac_3 family which is described as Bacterial extracellular solute-binding proteins, family 3 (PF00497)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19

PDB Hit:


Gene Protein Sequence:
VKIKFSWKVNFLICLLAVGLIFFGCSRVKREVLVGRDATWFPKQFGIYTS
DTNAFLNDLVSEINYKENLNINIVNQDWVHLFENLDDKKTQGAFTSVLPT
LEMLEHYQFSDPILLTGPVLVVAQDSPYQSIEDLKGRLIGVYKFDSSVLV
AQNIPDAVISLYQHVPIALEALTSNCYDALLAPVIEVTALIETAYKGRLK
IISKPLNADGLRLAILKGTNGDLLEGFNAGLVKTRRSGKYDAIKQRYRLP
$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGATAAAATTTTCTTGGAAGGTAAATTTTTTAATATGTTTACTGGC
TGTGGGACTGATCTTTTTCGGGTGCTCTCGAGTAAAAAGAGAAGTTCTCG
TAGGTCGTGATGCCACCTGGTTTCCAAAACAATTCGGCATTTATACATCC
GATACCAACGCATTTTTAAACGATCTTGTTTCTGAGATTAACTATAAAGA
GAATCTAAATATTAATATTGTAAATCAAGATTGGGTGCATCTCTTTGAGA
ATTTAGATGATAAAAAGACCCAAGGAGCATTTACATCTGTATTGCCTACT
CTTGAGATGCTCGAACACTATCAATTTTCTGATCCCATTTTACTCACAGG
TCCTGTCCTTGTCGTCGCTCAAGACTCTCCTTACCAATCTATAGAGGATC
TTAAAGGTCGTCTTATTGGAGTGTATAAGTTTGACTCTTCAGTTCTTGTA
GCTCAAAATATCCCTGACGCTGTGATTAGCCTCTACCAACATGTTCCAAT
AGCATTGGAAGCCTTAACATCGAATTGTTACGACGCTCTTCTAGCTCCTG
TAATTGAAGTGACCGCGCTAATAGAAACAGCATATAAAGGAAGACTGAAA
ATTATTTCAAAACCCTTAAACGCAGATGGTTTGCGGCTTGCAATACTGAA
AGGGACAAACGGAGATTTGCTTGAAGGGTTTAACGCAGGACTTGTGAAAA
CACGACGCTCAGGAAAATACGATGCTATAAAACAGCGGTATCGTCTTCCC
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy