Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR475 IGR481 IGR476 IGR480 IGR479 IGR478 IGR474 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 pyr5, - CPn0608 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 CPn0605 oppB_2, - CPn0598 oppB_2, - CPn0598 CPn0605 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0603

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemZ  

Definition:
ferrochelatase

Gene Start:
694205

Gene Stop:
695188

Gene Length:
984

Molecular Weight*:
37457

pI*:
9.90

Net Charge*:
12.84

EC:
4.99.1.1  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Comment:
In Synechocystis, this protein completes protoheme biosynthesis: iron is
added to protoporphyrin to form protoheme.

Blast Summary:  PSI-Blast Search
CPn0603 is orthologous to CT485, a predicted ferrochelatase: residues
6-308 are 55% similar to CT485. No similarity to T.pallidum, M.genitalium
or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0276
COG name: Protoheme ferro-lyase (ferrochelatase)
Functional Class:  H
The phylogenetic pattern of COG0276 is ----yq-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 309 (E-value = 4.5e-145) place CPn0603 in the Ferrochelatase family which is described as Ferrochelatase (PF00762)

PDB Hit:


Gene Protein Sequence:
VTTPAYLLANFGGPRHAKDLQEFLISLLTDRDVTGTFLPRVLHRHLFTFI
AKKRVPKVLPQYQSLQNWSPIYFDTETLAKTLSEILRAPVIPFHRYLPST
HEKTLLALRTLHTRHVIGIPLFPHFTYSVTGSIVRFFMKHVPEIPISWIP
QFGSDSKFVSLITCHIRDFLQKLGILEKECCFLFSVHGLPVRYISQGDPY
SKQCYESFSAITTNFKQSENFLCFQSKFGPGKWLSPSTAQLCQNIDTDKP
NVIVVPFGFISDHLETLYEIERDYLPLLRSRGYRALRIPAIYSSPLWVST
LVDIVKENSTVVAEELIKSGKKHTGIR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACAACTCCAGCCTATCTACTAGCTAATTTTGGAGGACCTCGTCATGC
TAAAGACCTTCAAGAATTTCTGATTTCTCTACTTACTGATAGAGATGTTA
CGGGCACTTTCCTTCCCAGAGTACTGCATAGGCATCTCTTTACTTTCATC
GCTAAAAAACGTGTTCCGAAAGTTCTCCCTCAATATCAATCTTTGCAAAA
TTGGTCTCCTATTTATTTTGACACCGAAACTCTTGCAAAAACACTCTCTG
AAATCTTACGAGCGCCTGTAATTCCATTTCACCGCTATCTACCCAGCACA
CATGAAAAGACGTTGCTTGCTTTGCGTACTCTACATACGCGTCACGTGAT
AGGTATCCCTTTATTCCCTCACTTCACCTATTCTGTTACGGGAAGCATTG
TACGTTTCTTTATGAAGCACGTGCCAGAAATCCCCATTTCTTGGATTCCC
CAATTTGGGAGTGATTCTAAATTTGTCTCTCTCATTACCTGCCACATTCG
GGATTTCCTTCAGAAGTTAGGAATCTTAGAAAAAGAGTGCTGCTTCTTAT
TTTCTGTACATGGACTTCCTGTACGCTATATCTCTCAAGGAGATCCCTAT
AGCAAGCAATGTTATGAATCATTTTCAGCAATTACGACAAACTTCAAGCA
ATCTGAGAATTTTCTTTGCTTCCAATCGAAGTTTGGTCCTGGAAAATGGC
TCTCCCCGTCCACTGCGCAACTATGTCAAAACATAGATACGGATAAGCCT
AATGTCATTGTTGTGCCTTTTGGCTTCATTTCTGATCACTTGGAAACTTT
ATATGAAATAGAAAGGGACTACCTGCCTCTGCTACGTTCTCGAGGATATC
GGGCATTACGAATCCCAGCGATTTATAGCTCCCCTCTTTGGGTATCGACT
TTGGTAGATATCGTGAAAGAAAACTCTACAGTAGTTGCCGAGGAGTTAAT
AAAGAGCGGGAAAAAACACACAGGGATTCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy