Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR475 IGR476 IGR479 IGR478 IGR474 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 CPn0605 oppB_2, - CPn0598 oppB_2, - CPn0598 CPn0605 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0602

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
694105

Gene Stop:
693101

Gene Length:
1005

Molecular Weight*:
38788

pI*:
7.80

Net Charge*:
2.84

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0602 is orthologously related to CT484: residues 1-333 of CPn0602 are 65% similar to residues 1-332 of CT484, a predicted hypothetical protein (basic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
30  
54
transmembrane  
59  
78
transmembrane  
172  
193

PDB Hit:


Gene Protein Sequence:
MKPLGFQENLEALCNKTSRQLLKYLIKQILFVCGASLLIALEFSFFLYFF
LFSGKTVIPAFCLACFFLTLFVCLVTRLYLLSGKGDFFEDLASEYLQGAV
PPNKRSQNIVEEQSHLAAAATKLSINLQNQEYSLLSEIFKFLPKHDLIRK
FSCFCFWKDYFLFRECLLQKAIEAYIKVVQAIPVDLSAHVSLADAYVALS
GLYADPRKYPEFDANYWIPSGRYSAEIQEKFFATARRAIEEFQILNEYAP
GNAWVHAQLAYSYHDLQMPMEEIQEYEIVLKLKPNDVETMSKLGILYFQQ
GMNAKGLRIYEEIKKRDYKKSQKLIKFYGVEYKY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCTTTAGGTTTTCAGGAGAATTTAGAAGCTTTATGTAATAAAAC
AAGTCGTCAGTTACTTAAGTATTTAATTAAGCAGATCCTCTTTGTTTGTG
GAGCCTCTCTTCTCATCGCTCTTGAGTTCAGTTTTTTTCTATATTTCTTT
CTATTCTCAGGGAAAACAGTCATTCCAGCATTCTGTCTTGCGTGTTTTTT
TCTTACATTGTTTGTTTGCCTTGTCACACGGCTCTATCTTCTTTCGGGGA
AAGGTGATTTTTTTGAGGATCTCGCTTCAGAGTATCTTCAAGGTGCTGTT
CCTCCCAATAAACGCTCCCAGAACATTGTAGAAGAGCAATCGCATTTAGC
GGCAGCAGCTACTAAATTATCTATAAATCTTCAGAATCAAGAATACTCTC
TTCTTTCTGAGATATTCAAATTCTTGCCCAAGCATGATCTCATTAGGAAA
TTTAGTTGTTTTTGTTTTTGGAAAGATTACTTTCTTTTTCGTGAATGTTT
ACTCCAAAAAGCGATCGAAGCTTATATCAAAGTGGTTCAAGCCATCCCTG
TAGATCTTAGTGCGCATGTCTCTTTAGCAGATGCGTATGTAGCTCTTTCT
GGTCTTTACGCAGATCCAAGGAAATACCCAGAGTTTGATGCTAATTATTG
GATCCCTTCGGGTAGATATAGCGCTGAGATTCAAGAAAAGTTTTTTGCAA
CGGCGCGAAGAGCTATTGAAGAGTTCCAAATTTTAAATGAGTATGCTCCA
GGTAACGCTTGGGTACACGCACAACTCGCTTATAGCTATCATGACTTGCA
AATGCCTATGGAAGAAATCCAAGAGTATGAAATTGTCCTAAAATTAAAAC
CTAATGATGTAGAAACGATGTCAAAGTTAGGAATACTTTATTTTCAGCAA
GGTATGAATGCTAAAGGTCTAAGAATTTACGAAGAGATAAAAAAAAGAGA
TTATAAAAAATCTCAAAAACTTATTAAATTTTATGGTGTTGAATATAAAT
ACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy