Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR475 IGR476 IGR479 IGR478 IGR474 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 glgC, - CPn0607 oppA_5,dppA, - CPn0599 CPn0605 oppB_2, - CPn0598 oppB_2, - CPn0598 oppC_2, - CPn0597 CPn0605 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0601

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
693053

Gene Stop:
692733

Gene Length:
321

Molecular Weight*:
11612

pI*:
4.90

Net Charge*:
-1.11

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0601 is somewhat orthologously related to CT483: residues 4-106 of CPn0601 are 31% similar to residues 6-108 of CT483, a predicted hypothetical protein from C. trachomatis.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
61
transmembrane  
73  
96

PDB Hit:


Gene Protein Sequence:
MDEITPNYPLLRQDSLWNRVRVSWRADLSVSSRYEIASAIAILGLLVAFC
ASAAVSIIFTANPLAQVFIDGCLALGLLPIPLVIGLLIIGIIVLLYGIYL
FPQQRE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACGAAATAACACCTAATTATCCTCTTTTAAGGCAAGACAGTCTGTG
GAATAGAGTCAGGGTTTCTTGGCGTGCGGATTTGTCTGTAAGTTCTCGTT
ACGAAATTGCTAGTGCTATAGCAATTCTAGGCTTATTAGTTGCCTTTTGT
GCTTCTGCTGCGGTAAGTATTATATTTACTGCGAACCCTCTTGCTCAGGT
ATTTATAGATGGCTGTTTGGCTTTAGGGCTTTTACCTATCCCATTGGTTA
TAGGTCTACTAATCATAGGAATTATAGTTTTACTCTATGGTATTTACTTG
TTTCCTCAACAACGCGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy