Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR473 IGR475 IGR476 IGR478 IGR474 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 CPn0606 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 hemZ, - CPn0603 CPn0601 CPn0600 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 CPn0605 oppB_2, - CPn0598 oppB_2, - CPn0598 CPn0606 CPn0605 hemZ, - CPn0603
* Calculated from Protein Sequence

Gene ID: CPn0600

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
692147

Gene Stop:
691824

Gene Length:
324

Molecular Weight*:
12557

pI*:
10.30

Net Charge*:
8.51

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKIKKSFQYSLCQAKRFQNMLPNHFDPCLQPVNLQLKQDRLAYGELIILL
SKYQQKTFSSLLKEETCSLNRAKQHLLYKILRDFNTMQHLRSLGLNGWGE
IPMSPCL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATTAAAAAATCTTTTCAATACAGTTTATGCCAAGCAAAGAGATT
TCAGAACATGCTGCCAAACCACTTTGATCCATGTTTGCAGCCAGTGAATT
TACAACTCAAACAAGACAGATTGGCATACGGGGAGCTCATCATATTGCTA
TCTAAATATCAACAAAAGACCTTTTCCTCTTTGTTGAAGGAAGAAACATG
TTCTCTTAATCGTGCGAAGCAGCACTTATTGTATAAGATTTTGAGAGATT
TTAATACTATGCAGCATCTAAGGTCCCTCGGATTAAATGGTTGGGGAGAG
ATCCCTATGAGTCCTTGCCTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy