Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR477 IGR470 IGR471 IGR473 IGR475 IGR476 IGR474 CPn0601 CPn0600 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 CPn0595 hemZ, - CPn0603 CPn0601 CPn0600 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 CPn0595 hemZ, - CPn0603 CPn0601 CPn0600 fliY, - CPn0604 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 oppB_2, - CPn0598 oppB_2, - CPn0598 CPn0595 hemZ, - CPn0603 ada, - CPn0596
* Calculated from Protein Sequence

Gene ID: CPn0599

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppA_5  dppA  

Definition:
oligopeptide transport system permease

Gene Start:
691802

Gene Stop:
689679

Gene Length:
2124

Molecular Weight*:
81072

pI*:
5.30

Net Charge*:
-20.72

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
See CT480.

Blast Summary:  PSI-Blast Search
CPn0599 is similar to CT480, a predicted oligopeptide transport system permease.
Residues 6-707 are 67% similar to CT480.
No significant similarity to M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0747
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, periplasmic components
Functional Class:  E
The phylogenetic pattern of COG0747 is a-TK-qVCEBRHUJ--OlIN-
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 432-510 are 39% similar to a defined domain of APPA_BACSU, defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR PEPTIDE OLIGOPEPTIDE LIPOPROTEIN BINDING OLIGOPEPTIDE-BINDING.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 79 to 686 (E-value = 2.3e-09) place CPn0599 in the SBP_bac_5 family which is described as Bacterial extracellular solute-binding proteins, family 5 (PF00496)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
26  
60

PDB Hit:


Gene Protein Sequence:
MYKRCVLDKILKGIVAGSLILLYWSSDLLERDIKSIKGNVRDIQEDIREI
SRVVKQQQTSQAIPAAPGVMLAPKLVRDEAFALLFGDPSYPNLLSLDPYK
QQTLPELLGTNFHPHGILRTAHVGKPENLSPFNGFDYVVGFYDLCIPSLA
SPHVGKYEEFSPDLAVKIEEHLVEDGSGDKEFHIYLRPNVFWRPIDPKAL
PKHVQLDEVFQRPHPVTAHDIKFFYDAVMNPYVATMRAVALRSCYEDVVS
VSVENDLKLVVRWKAHTVINEEGKEERKVLYSAFSNTLSLQPLPRFVYQY
FANGEKIIEDENIDTYRTNSIWAQNFTMHWANNYIVSCGAYYFAGMDDEK
IVFSRNPDFYDPLAALIDKRFVYFKESTDSLFQDFKTGKIDISYLPPNQR
DNFYSFMKSSAYNKQVAKGGAVRETVSADRAYTYIGWNCFSLFFQSRQVR
CAMNMAIDRERIIEQCLDGQGYTISGPFASSSPSYNKQIEGWHYSPEEAA
RLLEEEGWIDTDGDGIREKVIDGVIVPFRFRLCYYVKSVTAHTIADYVAT
ACKEIGIECSLLGLDMADLSQAFDEKNFDALLMGWCLGIPPEDPRALWHS
EGAMEKGSANVVGFHNEEADKIIDRLSYEYDLKERNRLYHRFHEIIHEEA
PYAFLFSRHCSLLYKDYVKNIFVPTHRTDLIPEAQDETVNVTMVWLEKKE
DPCLSTS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATAAAAGATGTGTGCTAGATAAAATTTTAAAGGGGATTGTCGCCGG
TTCTTTAATTTTGTTATACTGGTCCTCAGACCTACTTGAAAGAGACATTA
AGTCGATAAAAGGTAACGTAAGAGATATTCAAGAAGACATTCGTGAAATC
TCACGCGTAGTGAAACAACAGCAGACATCACAAGCTATCCCTGCGGCACC
TGGGGTGATGCTCGCTCCTAAGCTCGTCAGAGACGAAGCTTTTGCTCTAC
TCTTTGGAGATCCTAGTTATCCTAATTTACTTTCCCTAGACCCCTATAAA
CAGCAGACTCTTCCTGAACTTCTAGGAACAAATTTCCACCCTCATGGTAT
CCTACGCACTGCCCATGTCGGAAAACCCGAAAATCTGAGCCCTTTTAATG
GCTTTGATTATGTCGTGGGCTTTTACGATCTCTGTATTCCTAGTTTAGCT
TCTCCCCACGTAGGGAAATACGAAGAATTTTCTCCAGATCTCGCTGTGAA
AATAGAAGAACATCTTGTTGAAGATGGTTCTGGGGATAAAGAGTTTCACA
TCTATCTGAGGCCGAATGTTTTTTGGCGTCCTATAGATCCTAAGGCCCTT
CCAAAACACGTTCAGTTAGACGAAGTATTTCAACGTCCTCATCCTGTGAC
AGCTCATGATATTAAGTTTTTCTACGACGCTGTTATGAACCCTTATGTAG
CAACCATGCGAGCAGTGGCTCTGCGCTCTTGTTATGAAGATGTGGTTTCT
GTCTCAGTAGAAAACGATTTAAAATTAGTAGTCAGATGGAAAGCACACAC
GGTAATCAATGAAGAAGGAAAGGAAGAGCGCAAAGTGCTCTACTCTGCAT
TTTCTAATACCTTAAGCTTGCAGCCCCTCCCTAGATTTGTATATCAGTAT
TTTGCTAACGGGGAAAAAATCATTGAAGATGAGAATATCGATACCTACCG
AACCAATTCCATTTGGGCGCAAAACTTCACTATGCATTGGGCAAACAACT
ATATTGTAAGTTGTGGAGCCTACTACTTTGCAGGGATGGATGATGAGAAA
ATCGTGTTTTCTAGAAATCCTGACTTCTATGATCCTCTTGCGGCTCTTAT
TGACAAGCGTTTCGTCTATTTTAAGGAAAGCACAGACTCCCTATTCCAAG
ATTTTAAGACAGGGAAAATAGACATCTCTTACCTTCCACCCAACCAAAGA
GATAATTTCTATAGTTTTATGAAAAGCTCCGCTTATAACAAACAGGTAGC
TAAGGGAGGAGCCGTCCGTGAAACAGTCTCAGCAGATCGAGCATATACGT
ACATAGGATGGAATTGCTTTTCATTATTTTTCCAAAGCCGACAGGTGCGC
TGTGCTATGAACATGGCAATCGATAGAGAGAGGATTATCGAACAGTGCTT
GGATGGCCAAGGCTATACGATTAGTGGGCCTTTTGCTTCGAGTTCTCCTT
CTTATAATAAACAGATCGAAGGGTGGCATTATTCTCCAGAAGAAGCAGCT
CGTCTCCTGGAAGAAGAGGGATGGATAGATACCGATGGCGATGGAATCCG
AGAAAAAGTTATCGATGGTGTGATTGTCCCGTTCCGTTTCCGTTTATGCT
ATTATGTAAAGAGTGTCACCGCTCATACCATTGCAGATTACGTAGCTACT
GCTTGTAAGGAAATCGGAATCGAGTGTAGCCTTCTAGGACTAGATATGGC
CGATCTTTCGCAAGCTTTTGATGAAAAGAATTTCGATGCTCTTTTAATGG
GATGGTGTTTAGGAATTCCTCCTGAGGATCCTAGGGCTTTATGGCATTCT
GAAGGGGCTATGGAAAAGGGTTCAGCGAATGTTGTAGGTTTCCATAATGA
AGAAGCTGATAAAATCATAGACAGACTCAGCTACGAATACGATCTGAAAG
AACGTAATCGCCTGTACCACCGTTTCCATGAAATTATTCATGAGGAAGCT
CCTTATGCTTTCTTGTTCTCACGACATTGTTCCTTACTTTATAAGGATTA
TGTAAAAAATATTTTCGTACCTACACATAGAACAGATTTAATTCCTGAAG
CTCAGGATGAGACTGTCAACGTAACTATGGTATGGCTTGAGAAGAAGGAG
GATCCGTGCTTAAGTACATCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy