Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR470 IGR471 IGR473 IGR475 IGR474 CPn0601 CPn0600 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 pheT, - CPn0594 CPn0601 CPn0600 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 pheT, - CPn0594 CPn0601 CPn0600 CPn0602 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 oppB_2, - CPn0598 oppB_2, - CPn0598 ada, - CPn0596 pheT, - CPn0594 CPn0595 CPn0595
* Calculated from Protein Sequence

Gene ID: CPn0598

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppB_2  

Definition:
oligopeptide transport system permease (dipeptide permease?)

Gene Start:
689697

Gene Stop:
688216

Gene Length:
1482

Molecular Weight*:
55448

pI*:
9.80

Net Charge*:
12.85

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST over last half of sequence to oligopeptide transport system permease protein sequences; e.g. residues 1-493 are 67% similar to CT479, a predicted oligopeptide transport system permease (dipeptide permease?); residues 223-488 are 22% similar to MG077, a predicted oligopeptide transport system permease protein; residues 223-491 are 22% similar to UU562, a predicted oligopeptide transport system permease protein; residues 227-488 are 26% similar to DPPB_BACSU; and residues 223-488 are 28% similar to (D64000) oligopeptide transport system permease protein [Synechocystis sp.].
No significant similarity to T.pallidum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0601
COG name: Dipeptide/oligopeptide/nickel permeases
Functional Class:  E,P
The phylogenetic pattern of COG0601 is a-TK-qVCEBRHUJgpO-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 1-487 span five regions of similarity to blocks BP01681A,C-F (TRANSPORT PROTEIN PERMEASE TRA) with a combined E-value of 2e-46.

ProDom Summary:  Protein Domain Search
Residues 376-487 are 38% similar to a defined domain of DPPB_BACSU, defined as: TRANSPORT PROTEIN PERMEASE TRANSMEMBRANE SYSTEM PEPTIDE OLIGOPEPTIDE MEMBRANE INNER TRANSPORTER.
Residues 381-484 are 26% similar to a defined domain of O51688_BORBU, defined as: OLIGOPEPTIDE ABC TRANSPORTER, PERMEASE PROTEIN (OPPB-2).

Paralogs:  Local Blast Search
CPn0199 is a possible paralog. Residues 220-487 are 22% similar to CPn0199.

Pfam Summary:  Pfam Search
Residues 255 to 488 (E-value = 8.6e-30) place CPn0598 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
18
transmembrane  
260  
279
transmembrane  
294  
315
transmembrane  
353  
370
transmembrane  
411  
428
transmembrane  
433  
450
transmembrane  
458  
475

PDB Hit:


Gene Protein Sequence:
VLKYILKRLVLIPLTLFAIVSINFVILNAAPGDVLEEKSRDALGEAGKSD
KMRSYKGPDRYLQFREHYGLTLPIFFNTRPKITHKKIQTALQELANANNT
TPSAKNAAKSLVYWGDCAKFVMPALLFEADDASRDDKYRHIAADLFIRGG
VLQGFVGPNLSPEQRAQNKEIAESNAFLVRQLNEEDLDTKVEALKGWFQD
HGGTEVFCYSSKQFWKTFFLETRFARYMSRVLRLDFGTLRNDAHKTVISE
VIKRLRCSLVLSILPMIVGFVLCQIFGMIMALKRNRWIDHSLNFIFLILF
SIPVFVAVPWILDNFVINKTIPFTTIPMPYSGLRSPPEVFNELSTLGRIF
DLVSHGFLPFCAVSYGALAAQSRLSRSIFLEVLSQDFICAAKARGLRWFD
ILYKHVGKNAAVSIVTSLASSLGTLLGGALVVETLFNIDGFGNFFYQAIL
NRDHNVVLFSVLVGSALSLVGYLLGDICYVLLDPRVQLEGRRI$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTAAGTACATCCTAAAACGTCTAGTTTTAATCCCCCTGACTTTATT
TGCTATTGTCTCTATAAATTTTGTAATTTTAAATGCGGCTCCTGGAGATG
TCTTGGAAGAAAAGTCTAGGGACGCTTTGGGAGAAGCTGGAAAATCCGAT
AAGATGCGCTCTTACAAGGGCCCGGACCGTTATTTGCAGTTTCGAGAGCA
TTATGGCCTCACGCTCCCCATTTTTTTTAACACTCGCCCTAAGATCACTC
ATAAGAAGATTCAGACTGCACTCCAAGAACTTGCAAATGCAAATAATACT
ACTCCAAGTGCGAAAAATGCTGCTAAGTCCTTAGTCTATTGGGGGGATTG
TGCGAAGTTTGTTATGCCCGCATTGTTATTTGAAGCTGACGATGCTTCGC
GAGATGATAAATATCGCCATATTGCTGCAGACTTGTTTATTCGTGGTGGC
GTCCTCCAAGGATTTGTCGGCCCTAATCTTAGCCCAGAACAAAGAGCTCA
AAATAAAGAGATCGCAGAAAGTAATGCTTTTTTAGTAAGACAGCTTAACG
AAGAAGATCTCGATACTAAGGTGGAAGCTTTAAAAGGGTGGTTCCAAGAT
CATGGGGGAACAGAAGTTTTTTGCTATAGCTCTAAGCAGTTCTGGAAGAC
TTTTTTCTTAGAGACTCGCTTTGCTCGCTATATGTCCCGGGTGTTGCGGT
TAGATTTTGGAACTTTACGAAATGACGCACATAAGACTGTAATTTCAGAA
GTGATCAAGCGTTTACGTTGTTCTTTGGTCTTGTCAATTTTACCTATGAT
TGTAGGCTTTGTGTTATGCCAAATCTTTGGTATGATCATGGCATTGAAAA
GAAACCGCTGGATAGATCACTCTCTAAATTTCATTTTCCTTATTCTATTT
TCTATTCCTGTCTTTGTTGCGGTTCCCTGGATCTTAGATAACTTTGTTAT
TAATAAAACGATTCCATTTACCACAATTCCTATGCCTTACTCTGGGTTAC
GTTCGCCCCCAGAGGTTTTTAATGAGCTCAGTACTCTAGGACGTATCTTT
GACTTGGTGTCGCATGGGTTTTTACCTTTCTGTGCAGTGAGTTACGGAGC
TCTTGCCGCACAGTCACGATTAAGTCGTTCGATATTTTTAGAAGTATTAA
GCCAAGATTTTATTTGTGCTGCTAAAGCTCGAGGATTGCGTTGGTTTGAT
ATTCTATATAAGCACGTAGGGAAAAATGCTGCAGTCTCTATAGTGACCTC
TCTAGCCTCTTCATTAGGAACGTTACTTGGAGGGGCGTTGGTTGTAGAAA
CCCTATTCAATATAGATGGCTTTGGGAACTTCTTCTATCAGGCAATTTTA
AATCGAGATCACAATGTAGTTCTATTTTCTGTGCTTGTAGGATCGGCTCT
ATCTTTAGTGGGATATTTGCTCGGAGATATTTGCTACGTACTCTTAGATC
CTCGAGTTCAGCTAGAGGGAAGGAGGATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy