Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR470 IGR471 IGR473 IGR469 IGR474 CPn0600 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 pheT, - CPn0594 CPn0600 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 ada, - CPn0596 pheT, - CPn0594 CPn0600 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 oppB_2, - CPn0598 oppB_2, - CPn0598 ada, - CPn0596 pheT, - CPn0594 CPn0595 CPn0595
* Calculated from Protein Sequence

Gene ID: CPn0597

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppC_2  

Definition:
oligopeptide transport system permease

Gene Start:
688215

Gene Stop:
686476

Gene Length:
1740

Molecular Weight*:
66884

pI*:
10.10

Net Charge*:
17.44

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
In E.coli, the OPPC protein is an integral membrane protein responsible for translocation of oligopeptides across the membrane.

Blast Summary:  PSI-Blast Search
Numerous significant hits over last 240 residues to oligopeptide permease sequences; e.g. residues 1-578 are 60% similar to CT478, a predicted oligopeptide transport system permease; residues 368-572 are 27% similar to CT200, a predicted dipeptide ABC transporter; residues 366-572 are 28% similar to UU561, a predicted oligopeptide transport system permease protein; residues 368-576 are 30% similar to MG078, a predicted oligopeptide transport system permease protein; residues 357-575 are 29% similar to (AL031184) oligopeptide transport integral membrane protein [Streptomyces coelicolor]; and residues 366-576 are 34% similar to (AE000544) oligopeptide ABC transporter, permease protein (oppC) [Helicobacter pylori 26695].
No significant similarity to T.pallidum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1173
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, permease components
Functional Class:  E,P
The phylogenetic pattern of COG1173 is a-TK-qVCEBRHUj--o-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 382-433 and 441-490 represent blocks BP01681C-D (TRANSPORT PROTEIN PERMEASE TRA) with a combined E-value of 0.0012

ProDom Summary:  Protein Domain Search
Residues 460-575 are 34% similar to a defined domain of Q55017_XXXXX, defined as: TRANSPORT PROTEIN PERMEASE TRANSMEMBRANE SYSTEM PEPTIDE OLIGOPEPTIDE MEMBRANE INNER TRANSPORTER.
Residues 396-457 are 45% similar to a defined domain of O58539_PYRHO, defined as: TRANSPORT PROTEIN PERMEASE SYSTEM OLIGOPEPTIDE TRANSMEMBRANE PEPTIDE OPPC INNER MEMBRANE.

Paralogs:  Local Blast Search
CPn0200, a predicted oligopeptide permease, is a probable paralog: residues 368-569 are 29% similar to CPn0200.

Pfam Summary:  Pfam Search
Residues 376 to 578 (E-value = 5.1e-35) place CPn0597 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
290  
317
non-globular  
360  
435

PDB Hit:


Gene Protein Sequence:
MQKHPSFYQRFLSAYYKNLLASLSWKFFISVALIGIYAPLFASSKPLLVT
WHGEIFFPLLRYLFFPGYYTKPVDLFFNVLMVTFPFFILSFKLTRGWLRR
WLLGLCIISQCMIFAWAYSGKVQDPALAENLKKMRAEKVRENISKVNSEM
VMLLPKDTRTWEMERRYMSTYEQLGILIKAKYRKKQEASVKKYQVAFEEK
RQSPMPTLRHLEMKNEGICLKRLQQRVDKMQRPYEMAQQAWNRATDNYRP
FLMALTRIEHELRLADYNNWGQPEDLCIAYANVEKRAEPYKKSLLEIRQV
LEDYAKLRSAISFIQDKRLWIEKESEDLRILINPFFSSFHWEDDAGGSRE
MNKYVPWWQLSRVTRKDLLAALVFGIRIALVVAGIGITIALAIGIMIGLV
SGYFGGTVDMILSRFTEIWETMPVLFILMLVISITQQKSLLLNTVLLGCF
SWTGFSRYVRIEVLKQRDRGYVLAATNLGYSHYYIMVHQILPNAIVPVIS
LVPFAMMAMISCEAGLTFLGLGEESSASWGNLMREGVTGFPAESAVLWPP
AIILTMLLIAIALIGDGVRDALDPRLQDS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAAGCATCCTTCCTTTTATCAACGTTTTCTATCTGCTTACTATAA
AAATTTATTAGCCTCTTTATCATGGAAATTTTTTATTTCTGTCGCTCTGA
TTGGCATCTACGCTCCTTTATTTGCGAGTAGTAAACCTTTACTAGTCACC
TGGCATGGAGAGATCTTTTTTCCTTTACTGAGGTACTTGTTTTTCCCTGG
GTATTACACTAAACCAGTGGATCTCTTTTTCAACGTTTTGATGGTCACGT
TTCCCTTTTTCATACTTTCTTTTAAGTTGACTAGGGGGTGGTTACGTCGT
TGGTTGTTGGGGCTGTGCATCATTTCTCAATGTATGATTTTTGCTTGGGC
CTATAGTGGGAAAGTTCAAGATCCCGCGTTAGCTGAGAATTTAAAAAAAA
TGCGAGCTGAGAAGGTCCGAGAAAACATCAGTAAGGTGAATTCTGAGATG
GTCATGCTGCTCCCCAAAGATACACGTACTTGGGAGATGGAACGGCGGTA
TATGAGTACGTATGAGCAGTTGGGGATTCTCATTAAGGCAAAGTATCGAA
AGAAACAAGAGGCTTCTGTAAAGAAGTATCAGGTCGCTTTTGAAGAAAAA
CGGCAGTCTCCGATGCCAACATTGCGTCACTTAGAGATGAAAAATGAAGG
CATTTGCCTTAAAAGATTACAGCAAAGAGTCGACAAGATGCAGCGTCCCT
ATGAGATGGCGCAGCAAGCTTGGAATCGTGCTACGGACAACTACCGACCG
TTTCTGATGGCCTTGACAAGAATAGAGCATGAGCTCCGCCTCGCGGATTA
CAACAACTGGGGGCAACCTGAAGACCTTTGTATTGCTTATGCTAATGTAG
AGAAACGAGCAGAGCCCTATAAAAAATCTTTGTTGGAGATTCGTCAGGTA
CTTGAAGACTATGCCAAGCTGCGCAGCGCGATCAGTTTCATTCAAGATAA
GCGTTTGTGGATCGAGAAAGAGTCTGAAGATCTTCGCATTTTGATTAACC
CCTTTTTCAGTAGTTTCCATTGGGAAGATGATGCTGGGGGATCTCGAGAA
ATGAACAAGTATGTTCCTTGGTGGCAGCTTAGCAGAGTCACTCGGAAAGA
TTTACTAGCGGCTTTAGTATTTGGCATTCGCATAGCTTTGGTAGTCGCAG
GTATTGGGATTACGATAGCTTTAGCTATCGGGATTATGATCGGGTTGGTT
TCTGGATATTTCGGTGGGACCGTGGATATGATTTTATCTCGGTTTACTGA
AATTTGGGAGACCATGCCTGTGCTGTTTATCTTAATGCTGGTGATTTCCA
TAACACAGCAGAAATCTTTGCTATTGAACACAGTTTTGCTAGGCTGTTTT
AGTTGGACAGGGTTTAGTAGGTATGTCCGTATTGAGGTGTTGAAACAGCG
AGACCGAGGTTATGTTCTTGCTGCTACAAACTTAGGGTATAGCCACTATT
ATATTATGGTGCATCAGATCCTTCCCAATGCCATTGTCCCTGTGATCTCT
TTAGTTCCGTTTGCTATGATGGCTATGATTAGCTGTGAGGCAGGGCTGAC
CTTTTTAGGTCTGGGGGAAGAGAGTTCCGCGTCTTGGGGAAATCTTATGA
GGGAGGGTGTTACAGGATTCCCTGCAGAGAGTGCTGTTCTTTGGCCTCCA
GCAATTATATTAACGATGTTGCTGATTGCGATCGCTCTGATAGGAGACGG
AGTCCGTGATGCTTTAGATCCCCGTCTGCAAGACTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy