Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR470 IGR471 IGR469 IGR468 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 CPn0592 ada, - CPn0596 CPn0591 pheT, - CPn0594 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 CPn0592 ada, - CPn0596 CPn0591 pheT, - CPn0594 CPn0593 oppC_2, - CPn0597 oppA_5,dppA, - CPn0599 oppB_2, - CPn0598 oppB_2, - CPn0598 ada, - CPn0596 CPn0591 pheT, - CPn0594 CPn0595 CPn0595 CPn0592
* Calculated from Protein Sequence

Gene ID: CPn0595

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
684958

Gene Stop:
685929

Gene Length:
972

Molecular Weight*:
36670

pI*:
6.80

Net Charge*:
-1.00

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0595 is orthologously related to CT476: residues 1-322 of CPn0595 are 66% similar to residues 1-320 of CT476, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19

PDB Hit:


Gene Protein Sequence:
MKQLLFCVCVFAMSCSAYASPRRQDPSVMKETFRNNYGIIVSGQEWVKRG
SDGTITKVLKNGATLHEVYSGGLLHGEITLTFPHTTALDVVQIYDQGRLV
SRKTFFVNGLPSQEELFNEDGTFVLTRWPDNNDSDTITKPYFIETTYQGH
VIEGSYTSFNGKYSSSIHNGEGVRSVFSSNNILLSEETFNEGVMVKYTTF
YPNRDPESITHYQNGQPHGLRLTYLQGGIPNTIEEWRYGFQDGTTIVFKN
GCKTSEIAYVKGVKEGLELRYNEQEIVAEEVSWRNDFLHGERKIYAGGIQ
KHEWYYRGRSVSKAKFERLNAAG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAATTACTTTTCTGTGTTTGCGTATTTGCTATGTCATGTTCTGC
TTACGCATCCCCACGACGACAAGATCCTTCTGTTATGAAGGAAACATTCC
GAAATAATTATGGCATTATTGTTTCCGGTCAAGAATGGGTAAAGCGTGGT
TCTGACGGCACCATCACCAAAGTACTCAAAAATGGAGCTACCCTGCATGA
AGTTTATTCTGGAGGCCTCCTTCATGGGGAAATTACCTTAACGTTTCCCC
ATACCACAGCATTGGACGTTGTTCAAATCTATGATCAAGGTAGACTCGTT
TCTCGCAAAACCTTTTTTGTGAACGGTCTTCCATCTCAAGAAGAGCTGTT
CAATGAAGATGGCACGTTTGTCCTCACACGATGGCCGGACAACAACGACA
GTGATACCATCACAAAGCCTTACTTCATAGAAACGACATATCAAGGGCAT
GTCATAGAAGGAAGTTATACTTCCTTTAATGGGAAATACTCCTCATCCAT
CCACAATGGAGAGGGAGTTCGTTCTGTGTTCTCCTCCAATAACATCCTTC
TTTCTGAAGAGACCTTCAATGAAGGTGTCATGGTGAAATATACCACATTC
TATCCGAATCGCGATCCCGAATCGATTACTCATTATCAAAATGGACAGCC
TCACGGCTTACGGCTAACATATCTACAAGGTGGCATCCCCAATACGATAG
AGGAGTGGCGTTATGGCTTTCAAGACGGAACGACCATCGTATTTAAAAAT
GGTTGTAAGACATCTGAGATCGCTTATGTTAAGGGAGTGAAAGAAGGTTT
AGAACTGCGCTACAATGAACAGGAAATTGTAGCTGAAGAAGTTTCTTGGC
GTAATGATTTTCTGCATGGAGAACGTAAGATCTATGCTGGAGGAATCCAA
AAGCATGAATGGTATTACCGCGGGAGATCTGTATCTAAAGCCAAATTCGA
GCGGCTAAATGCTGCAGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy