Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_2 IGR470 IGR471 IGR469 IGR466 IGR468 IGR467 CPn0590 CPn0593 oppB_2, - CPn0598 oppC_2, - CPn0597 CPn0592 ada, - CPn0596 CPn0591 CPn0589 pheT, - CPn0594 CPn0590 CPn0593 oppB_2, - CPn0598 oppC_2, - CPn0597 CPn0592 ada, - CPn0596 CPn0591 CPn0589 pheT, - CPn0594 CPn0590 CPn0593 oppB_2, - CPn0598 oppC_2, - CPn0597 ada, - CPn0596 CPn0591 CPn0589 pheT, - CPn0594 CPn0595 CPn0595 CPn0592
* Calculated from Protein Sequence

Gene ID: CPn0594

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta subunit

Gene Start:
682583

Gene Stop:
684961

Gene Length:
2379

Molecular Weight*:
87786

pI*:
5.50

Net Charge*:
-18.52

EC:
6.1.1.20  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
In B.subtilis, the phe-tRNA synthetase is a tetramer composed of two alpha and
two beta subunits.

Blast Summary:  PSI-Blast Search
CPn0594 is orthologously related to CT475: residues 1-785 of CPn0594 are 54% similar to residues 1-784 of CT475, a predicted phenylalanyl-tRNA synthetase beta subunit from C. trachomatis.
CPn0594 is also similar to MG195 and UU457.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0072
COG name: Phenylalanyl-tRNA synthetase beta subunit
Functional Class: J
The phylogenetic pattern of COG0072 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 45 to 152 (E-value = 1.2e-36) place CPn0594 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 155 to 298 (E-value = 4.1e-60) place CPn0594 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 405 to 473 (E-value = 1.5e-23) place CPn0594 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)
Residues 695 to 784 (E-value = 3.5e-38) place CPn0594 in the FDX-ACB family which is described as Ferredoxin-fold anticodon binding domain (PF03147)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
123  
192
non-globular  
260  
321

PDB Hit:


Gene Protein Sequence:
MRIPITLLQTYFSEPLSTKEILEACDHIGIEAEIENTTLYSFASVITAKI
LHTIPHPNADKLRVATLTDGEKEHQVVCGAPNCEAGLIVALALPGAKLFD
SEGQAYTIKKSKLRGVESQGMCCGADELGLDELQIQERALLELPEATPLG
EDLATVLGNTSLEISLTPNLGHCASFLGLAREICHVTQANLVIPKEFSFE
NLPTTALDMGNDPDICPFFSYVVITGISAQPSPIKLQESLQALKQKPINA
IVDITNYIMLSLGQPLHAYDASHVALDSLRVEKLSTPESLTLLNGETVLL
PSGVPVVRDDHSLLGLGGVMGAKAPSFQETTTTTVIKAAYFLPEALRASQ
KLLPIPSESAYRFTRGIDPQNVVPALQAAIHYILEIFPEATISPIYSSGE
ICRELKEVALRPKTLQRILGKSFSIEILSQKLQSLGFSTTPQETSLLVKV
PSYRHDINEEIDLVEEICRTESWNIETQNPVSCYTPIYKLKRETAGFLAN
AGLQEFFTPDLLDPETVALTRKEKEEISLQGSKHTTVLRSSLLPGLLKSA
ATNLNRQAPSVQAFEIGTVYAKHGEQYQETQTLAILLTEDGESRSWLPKP
SLSFYSLKGWVERLLYHHHLSIDALTLESSALCEFHPYQQGVLRIHKQSF
ATLGQVHPELAKKAQIKHPVFFAELNLDLLCKMLKKTTKLYKPYAIYPSS
FRDLTLTVPEDIPANLLRQKLLHEGSKWLESVTIISIYQDKSLETRNKNV
SLRLVFQDYERTLSNQDIEEEYCRLVALLNELLTDTKGTINS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGATTCCAATAACTCTACTGCAAACATACTTTTCAGAACCTCTTTC
GACAAAGGAAATTTTAGAAGCCTGTGATCATATTGGCATAGAAGCCGAGA
TTGAAAATACTACCCTATACTCTTTCGCTTCTGTGATTACAGCAAAAATT
TTACATACGATTCCCCATCCTAATGCGGATAAACTCCGGGTAGCTACCCT
GACCGACGGGGAAAAAGAGCACCAAGTGGTTTGCGGAGCCCCCAACTGCG
AAGCAGGATTGATTGTAGCTCTTGCTCTACCTGGAGCCAAATTATTTGAT
AGCGAAGGACAAGCCTACACAATCAAAAAATCTAAACTTCGTGGTGTAGA
ATCTCAAGGGATGTGCTGCGGAGCCGACGAGTTGGGCCTTGATGAACTCC
AAATTCAGGAGAGAGCTCTTTTAGAGCTCCCAGAAGCCACCCCTTTAGGT
GAAGATCTCGCAACAGTTTTAGGGAATACTTCTTTAGAGATCTCTCTAAC
ACCGAATTTAGGCCACTGCGCCTCCTTCCTAGGATTGGCCCGAGAAATCT
GCCACGTCACTCAGGCAAACCTCGTCATCCCTAAGGAATTCTCGTTCGAA
AATCTCCCGACTACAGCCCTAGACATGGGCAATGATCCTGACATTTGCCC
CTTCTTTTCTTATGTCGTCATTACGGGAATCTCTGCGCAACCTTCACCAA
TCAAGCTTCAGGAATCTCTACAAGCCCTCAAACAAAAGCCCATAAATGCT
ATTGTCGATATTACAAATTACATCATGCTTTCTCTAGGGCAACCTCTGCA
CGCTTACGATGCGAGTCACGTCGCTTTAGACTCTCTGCGAGTAGAAAAGC
TCTCCACCCCAGAATCTCTCACCCTATTGAACGGAGAAACCGTCCTCTTG
CCCTCAGGAGTGCCTGTAGTCCGCGATGATCATAGTCTCTTGGGTCTTGG
AGGTGTTATGGGAGCGAAAGCACCCTCATTTCAAGAAACCACAACCACTA
CAGTCATCAAAGCTGCCTATTTCCTCCCCGAAGCTCTCCGTGCCTCTCAA
AAACTTCTCCCGATTCCATCGGAATCTGCCTATAGATTCACCCGGGGGAT
CGATCCACAAAATGTTGTACCAGCACTACAAGCTGCAATTCACTATATTT
TAGAGATCTTCCCCGAAGCTACAATCTCCCCCATCTATAGTTCTGGAGAA
ATTTGTCGTGAATTAAAAGAGGTCGCTCTACGCCCTAAAACCCTACAGAG
AATTCTAGGGAAATCTTTCTCAATAGAGATCCTCTCTCAAAAGTTACAGA
GCTTAGGGTTCTCTACGACTCCACAAGAAACTTCCTTACTTGTAAAAGTC
CCTTCCTACCGCCATGACATCAATGAAGAAATAGATCTAGTAGAAGAGAT
CTGTAGGACAGAATCTTGGAATATAGAAACTCAAAATCCAGTATCCTGCT
ACACTCCAATCTACAAACTAAAACGTGAAACTGCTGGGTTCCTAGCAAAC
GCAGGACTTCAAGAATTCTTCACTCCTGACCTGCTAGATCCCGAAACAGT
GGCTCTAACAAGAAAAGAAAAAGAAGAAATCTCTCTTCAGGGCTCCAAAC
ATACCACTGTATTGAGATCCTCACTGCTTCCAGGATTATTAAAAAGTGCT
GCGACAAACCTAAATCGCCAGGCACCCTCTGTTCAAGCTTTTGAGATCGG
CACTGTCTATGCAAAACATGGAGAGCAGTATCAAGAAACTCAAACTCTGG
CGATCCTGCTCACTGAAGATGGCGAATCCAGGTCCTGGCTCCCCAAACCC
TCTCTTTCTTTTTATTCTTTAAAGGGGTGGGTAGAGAGGCTGCTCTATCA
CCACCATCTTTCTATAGATGCTTTGACCTTAGAGTCCAGCGCGCTCTGCG
AATTTCACCCCTACCAACAGGGAGTGTTGCGCATCCACAAACAGAGTTTT
GCTACTTTAGGTCAGGTACATCCTGAGTTAGCAAAAAAAGCACAGATAAA
ACACCCTGTGTTCTTTGCAGAACTCAACTTAGACCTTCTATGCAAGATGC
TAAAAAAAACAACGAAGCTTTATAAACCTTACGCCATATATCCTTCATCT
TTTCGTGATCTCACCTTGACAGTACCTGAAGACATCCCTGCAAATTTACT
GAGACAAAAACTTTTACACGAAGGTTCTAAATGGCTTGAAAGTGTAACCA
TTATCAGTATATATCAAGATAAAAGCTTGGAAACACGAAATAAAAATGTT
TCTCTACGCCTCGTATTCCAAGATTATGAGCGAACATTATCTAACCAAGA
CATTGAAGAAGAATACTGTCGTTTGGTAGCTTTACTTAACGAATTGCTAA
CAGACACTAAAGGGACTATCAATTCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy