Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR470 IGR465 IGR471 IGR469 IGR466 IGR468 IGR464 IGR467 CPn0590 CPn0593 oppC_2, - CPn0597 CPn0592 ada, - CPn0596 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 oppC_2, - CPn0597 CPn0592 ada, - CPn0596 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 oppC_2, - CPn0597 ada, - CPn0596 CPn0591 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0595 CPn0595 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0593

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
682476

Gene Stop:
681388

Gene Length:
1089

Molecular Weight*:
42041

pI*:
7.70

Net Charge*:
3.29

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0593 is orthologously related to CT474: residues 1-292 of CPn0593 are 48% similar to residues 38-329 of CT474, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1388
COG name: Predicted lytic murein transglycosylase
Functional Class:  N
The phylogenetic pattern of COG1388 is -----q--eB-h----o-IN-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 316 to 358 (E-value = 4.4e-16) place CPn0593 in the LysM family which is described as LysM domain (PF01476)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
34

PDB Hit:


Gene Protein Sequence:
MAFKRKTRWLWQVLILSVGLNMLFLLLFYSAIFRKDIYKLHLFSGPLIAK
SSRKVYLSEDFLNEISQASLDDLISLFKDERYMYGRPIKLWALSVAIASH
HIDITPVLSKPLTYTELKGSSVRWLLPNIDLKDFPVILDYLRCHKYPYTS
KGLFLLIEKMVQEGWVDEDCLYHFCSTPEFLYLRTLLVGADVQASSVASL
ARMVIRCGSERFFHFCNEESRTSMISATQRQKVLKSYLDCEESLAALLLL
VHDSDVVLHEFCDEDLEKVIRLMPQESPYSQNFFSRLQHSPRRELACMST
QRVEAPRVQEDQDEEYVVQDGDSLWLIAKRFGIPMDKIIQKNGLNHHRLF
PGKVLKLPAKQS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTTCAAAAGAAAAACTAGATGGCTGTGGCAAGTCTTGATCCTGAG
TGTGGGATTGAATATGCTTTTTTTGCTCTTATTTTACTCTGCCATATTTC
GTAAAGACATCTATAAGCTGCATTTATTTTCCGGACCTTTGATTGCGAAA
AGTAGTCGTAAGGTCTACCTTTCTGAAGATTTTTTAAACGAGATATCTCA
AGCATCTTTGGACGACTTGATTTCGTTGTTCAAAGATGAGCGCTATATGT
ATGGTCGGCCGATAAAACTTTGGGCGTTGAGTGTAGCGATAGCTTCCCAC
CACATAGACATCACTCCTGTGCTTTCGAAGCCTTTGACCTATACAGAGTT
GAAAGGATCTTCAGTGCGGTGGCTTTTGCCGAATATTGATCTTAAAGACT
TTCCTGTGATTTTGGACTATTTGCGTTGCCACAAGTATCCCTATACTTCT
AAGGGCTTGTTTTTGCTGATAGAAAAGATGGTACAAGAAGGCTGGGTAGA
TGAAGATTGCCTGTATCATTTCTGCTCGACTCCAGAATTTCTTTACTTGC
GTACGTTACTTGTAGGTGCAGACGTGCAGGCCTCTTCAGTAGCCTCATTA
GCTCGTATGGTGATTCGTTGCGGATCCGAACGTTTCTTTCATTTTTGCAA
TGAAGAGAGCCGCACTTCCATGATTTCAGCTACACAACGTCAGAAAGTCT
TAAAATCTTATTTAGATTGTGAAGAATCTCTGGCAGCCTTGCTTTTGCTT
GTCCATGATAGTGATGTTGTTTTGCATGAATTTTGTGATGAAGATCTTGA
GAAGGTCATCCGCCTGATGCCTCAAGAGTCTCCCTATAGTCAGAATTTCT
TCTCTCGATTACAGCATTCTCCGCGTAGAGAGTTGGCCTGCATGTCGACT
CAGAGGGTAGAGGCTCCTCGTGTTCAAGAAGATCAGGATGAAGAGTATGT
GGTACAGGACGGGGATTCTTTATGGTTGATAGCTAAGAGGTTTGGCATTC
CTATGGATAAGATCATTCAGAAAAATGGCTTGAATCACCACCGTCTATTT
CCTGGTAAGGTTCTAAAACTTCCTGCAAAGCAGTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy