Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR470 IGR465 IGR469 IGR466 IGR468 IGR464 IGR467 CPn0590 CPn0593 CPn0592 ada, - CPn0596 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0592 ada, - CPn0596 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 ada, - CPn0596 CPn0591 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0595 CPn0595 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0592

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)

Gene Start:
681153

Gene Stop:
681464

Gene Length:
312

Molecular Weight*:
11734

pI*:
7.70

Net Charge*:
1.66

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
YidD-like protein (yidD).

Blast Summary:  PSI-Blast Search
CPn0592 is orthologously related to CT473: residues 18-87 of CPn0592 are 54% similar to residues 13-82 of CT473, a predicted conserved hypothetical protein (basic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0759
COG name: Uncharacterized ACR, YidD family
Functional Class:  S
The phylogenetic pattern of COG0759 is -----qvcebrhuj--o-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 78 (E-value = 1.2e-32) place CPn0592 in the DUF37 family which is described as Domain of unknown function DUF37 (PF01809)

PDB Hit:


Gene Protein Sequence:
MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKS
HGFLMGCWLSIKRIGKCGPWHPGGIDMVPKTALQEVLEPYQEIDGGDSSH
FSE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATTTAAACGTTTCTTGCAACAGATCCCTGTACGTATCTGTCTACT
TATTATCTATCTCTACCAATGGCTTATCTCCCCTCTCTTAGGCTCGTGCT
GTAGATTTTTTCCTTCCTGTTCGCACTATGCAGAACAAGCCTTAAAATCT
CACGGCTTCCTGATGGGCTGCTGGCTTTCTATAAAGAGAATCGGAAAGTG
TGGCCCCTGGCATCCTGGAGGCATTGACATGGTCCCTAAGACTGCTTTGC
AGGAAGTTTTAGAACCTTACCAGGAAATAGACGGTGGTGATTCAAGCCAT
TTTTCTGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy