Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR465 IGR469 IGR466 IGR468 IGR463 IGR464 IGR467 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0591 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0595 CPn0595 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0591

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
680373

Gene Stop:
681023

Gene Length:
651

Molecular Weight*:
24617

pI*:
6.70

Net Charge*:
-0.99

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible YagE protein (yagE).

Blast Summary:  PSI-Blast Search
CPn0591 is orthologously related to CT472: residues 1-214 of CPn0591 are 71% similar to residues 1-214 of CT472, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1723
COG name: Uncharacterized ACR, YDL001w/YagE family
Functional Class:  S
The phylogenetic pattern of COG1723 is ----Y-------------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 216 (E-value = 1.6e-135) place CPn0591 in the DUF155 family which is described as Uncharacterised ACR, YagE family COG1723 (PF02582)

PDB Hit:


Gene Protein Sequence:
MRCTAYCTASAYNLHVLFHLLKPRYPTILSREYVLANLDSTQASNQLAIF
FPFGVAVFWGWEESEEIKLLQTIVTASPEILPQPEIDCYNFHYGDKLQIR
RDRLTLADTTLNTKLAIAFGLAQSVKLTTFETTIYKTIEDSKRLPQDLAT
KGKISMSRKAIAKKIGKLFLDKASVNLHSDILDEPDFFWDHPETQAIYRD
VLSCLDIEARINVLIV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTTGCACTGCCTACTGTACAGCATCTGCTTATAACCTCCATGTCCT
TTTCCACCTACTTAAACCCCGCTATCCTACCATCTTATCTAGAGAATATG
TTCTCGCAAACCTAGATAGTACACAGGCAAGCAACCAGTTAGCGATCTTC
TTCCCTTTCGGAGTTGCCGTATTCTGGGGTTGGGAAGAGTCCGAAGAAAT
CAAACTTTTACAAACAATCGTTACAGCATCACCAGAAATTCTTCCCCAAC
CCGAGATCGATTGCTATAACTTTCATTACGGAGATAAACTCCAAATCCGG
AGGGACCGCCTGACCCTTGCCGACACCACATTAAATACAAAGCTCGCCAT
TGCTTTTGGTCTGGCGCAATCGGTAAAACTCACAACCTTCGAAACTACAA
TCTATAAAACTATAGAAGATTCTAAACGGCTTCCCCAAGATCTTGCTACT
AAAGGAAAAATTTCCATGTCTCGGAAAGCCATCGCAAAAAAGATTGGCAA
GCTCTTCCTAGATAAGGCTTCAGTAAACCTTCATTCCGATATCTTGGATG
AACCTGATTTTTTCTGGGATCATCCAGAAACACAGGCGATTTATCGTGAC
GTTCTCAGTTGTTTAGATATTGAGGCACGAATCAATGTTCTTATCGTTTG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy