Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR465 IGR469 IGR466 IGR468 IGR463 IGR464 IGR467 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0591 CPn0589 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0589

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
678640

Gene Stop:
679398

Gene Length:
759

Molecular Weight*:
28839

pI*:
8.70

Net Charge*:
7.36

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0589 is orthologously related to CT470: residues 1-227 of CPn0589 are 49% similar to residues 1-228 of CT470, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1381
COG name: Recombination protein RecO
Functional Class:  L
The phylogenetic pattern of COG1381 is -------cebrh-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 243 (E-value = 2.3e-119) place CPn0589 in the RecO family which is described as Recombination protein O (PF02565)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
128  
145
transmembrane  
202  
219

PDB Hit:


Gene Protein Sequence:
MQICVTGVVLRSRPLGKNHTLTTLFTPEGLFTFFAKQGQTLQCDYRETLV
PISLGKYTLHRNGSRLPKLTHGDILNAFEAIKQTYALLEASGKMIQALLA
SQWKEKPSHKLFSLFLNFLHRIPESSNPEFFAAIFVLKLLQYEGILDLTP
ACSLCKASLPYACYRYQGHKLCKKHQHKQAISIEKEEEQILQAIIHAKQF
SELLAIAEFPIAIAEKIFYLFDSLQEEKKSERNSSEDPYHEILRLSKVVH
PY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGATCTGTGTTACCGGCGTTGTACTTCGCAGCCGCCCCTTAGGAAA
AAATCATACACTCACCACTTTATTTACCCCTGAAGGACTCTTTACCTTTT
TTGCAAAGCAAGGACAAACCCTCCAATGTGATTATCGAGAAACCCTTGTC
CCCATATCTTTGGGGAAGTATACGTTACATCGTAATGGCTCACGCCTTCC
TAAACTGACCCACGGGGATATCCTCAATGCCTTCGAAGCAATCAAACAAA
CCTACGCTCTCCTAGAAGCTAGTGGAAAAATGATTCAAGCTCTTCTGGCT
TCTCAGTGGAAAGAAAAGCCTTCGCATAAGCTCTTCTCTTTATTCTTGAA
TTTCCTCCACCGTATTCCTGAAAGCAGCAATCCAGAATTTTTTGCAGCCA
TCTTTGTACTTAAACTTCTCCAATACGAAGGAATCCTAGACCTGACTCCA
GCATGTTCGCTATGCAAAGCATCTCTACCCTATGCCTGCTATCGCTACCA
AGGCCATAAACTATGTAAGAAACATCAGCATAAACAAGCCATCTCCATCG
AGAAAGAAGAAGAACAAATCTTACAGGCTATCATTCATGCGAAGCAGTTT
TCTGAACTTCTAGCTATTGCAGAATTCCCGATTGCTATAGCTGAAAAAAT
TTTTTATTTGTTTGACTCGCTACAAGAGGAAAAAAAATCAGAAAGAAATT
CTTCGGAAGATCCATATCATGAAATCCTAAGACTTTCTAAAGTAGTCCAT
CCCTACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy