Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR465 IGR462 IGR469 IGR466 IGR468 IGR463 IGR464 IGR467 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0591 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0588

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
678084

Gene Stop:
678629

Gene Length:
546

Molecular Weight*:
20414

pI*:
9.90

Net Charge*:
5.62

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0588 is orthologously related to CT469: residues 14-177 of CPn0588 are 43% similar to residues 2-165 of CT469, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralog in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
118

PDB Hit:


Gene Protein Sequence:
MSLLNLPSSQDSASEDSTSQSQIFDPIRNRELVSTPEEKVRQRLLSFLMH
KLNYPKKLIIIEKELKTLFPLLMRKGTLIPKRRPDILIITPPTYTDAQGN
THNLGDPKPLLLIECKALAVNQNALKQLLSYNYSIGATCIAMAGKHSQVS
ALFNPKTQTLDFYPGLPEYSQLLNYFISLNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCTTATTGAACCTTCCCTCAAGCCAGGATTCTGCATCTGAGGACTC
CACATCGCAATCTCAAATCTTCGATCCCATTAGAAATCGGGAGTTAGTTT
CTACTCCCGAAGAAAAAGTCCGCCAAAGGTTGCTCTCCTTCCTAATGCAT
AAGCTGAACTACCCTAAGAAACTCATCATCATAGAAAAAGAACTCAAAAC
TCTTTTTCCTCTGCTTATGCGTAAAGGAACCCTAATCCCAAAACGCCGCC
CAGATATTCTCATCATCACTCCCCCCACATACACAGACGCACAGGGAAAC
ACTCACAACCTAGGCGACCCAAAACCCCTGCTACTTATCGAATGTAAGGC
CTTAGCCGTAAACCAAAATGCACTCAAACAACTCCTTAGCTATAACTACT
CTATCGGAGCCACCTGCATTGCTATGGCAGGGAAACACTCTCAAGTGTCA
GCTCTCTTCAATCCAAAAACACAAACTCTTGATTTTTATCCTGGCCTCCC
AGAGTATTCCCAACTCCTAAACTACTTTATTTCTTTAAACTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy