Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 IGR465 IGR462 IGR469 IGR466 IGR468 IGR463 IGR464 IGR467 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0590 CPn0593 CPn0585 CPn0591 CPn0589 atoS, - CPn0584 atoC, - CPn0586 pheT, - CPn0594 CPn0588 CPn0587 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0587

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
677441

Gene Stop:
678127

Gene Length:
687

Molecular Weight*:
26015

pI*:
10.40

Net Charge*:
14.80

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
The single similarity to YVYD_BACSU led to a classification of this sequence as a conserved hypothetical protein rather than as a hypothetical protein, but it should be noted that this similarity is quite weak and may be insignificant.

Blast Summary:  PSI-Blast Search
Single weak hit in gapped BLAST; residues 53-221 are 25% similar to residues 39-188 of YVYD_BACSU. This equates to an E-value of 4e-05.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1544
COG name: Ribosome-associated protein Y (PSrp-1)
Functional Class:  K
The phylogenetic pattern of COG1544 is -----qvcEbrh----o--nx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 167-220 are 31% similar to a defined domain of YVYD_BACSU, defined as: PROTEIN RIBOSOMAL LIGHT REPRESSED A CHLOROPLAST HOMOLOG 30S S30 PRECURSOR. This alignment results in a weak E-value of 1.2e-05.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
176  
210

PDB Hit:


Gene Protein Sequence:
MRPHRKHVSSKSLALKQSASTHVEITTKAFRLSMPLKQLILEKSDHLPPM
ETIRVVLTSHKDKLGTEVHVVASHGKEILQTKVHNANPYTAVINAFKKIR
TMANKHSNKRKDRTKHDLGLAAKEERIAIQEEQEDRLSNEWLPVEGLDAW
DSLKTLGYVPASAKKKISKKKMSIRMLSQDEAIRQLESAAENFLIFLNEQ
EHKIQCIYKKHDGNYVLIEPSLKPGFCI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGACCTCATCGTAAACACGTATCATCTAAAAGCTTAGCTTTAAAGCA
ATCTGCATCAACTCATGTAGAGATCACAACAAAAGCCTTTCGTCTCTCTA
TGCCTCTAAAACAGCTGATCCTAGAGAAAAGCGACCACCTCCCCCCTATG
GAAACAATCCGTGTGGTGCTAACCTCTCATAAAGATAAGCTAGGCACCGA
GGTGCATGTTGTAGCTTCTCATGGCAAAGAAATCCTTCAAACTAAGGTTC
ATAACGCAAACCCATACACTGCAGTGATCAATGCTTTTAAGAAAATCCGC
ACCATGGCAAATAAGCACTCCAATAAACGTAAAGACAGGACAAAACATGA
TCTAGGTCTTGCAGCAAAAGAAGAACGTATCGCAATACAGGAAGAACAAG
AAGATCGCCTTAGCAACGAGTGGCTTCCTGTCGAAGGCCTCGATGCCTGG
GATTCTCTAAAAACTCTTGGGTATGTTCCCGCATCAGCGAAAAAGAAGAT
CTCCAAGAAAAAGATGAGCATTCGTATGCTATCTCAAGACGAGGCTATCC
GCCAGCTAGAGTCTGCCGCAGAAAACTTCCTGATCTTCTTGAACGAGCAA
GAGCATAAAATCCAATGCATTTATAAAAAACATGACGGCAACTATGTCCT
TATTGAACCTTCCCTCAAGCCAGGATTCTGCATCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy