Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_2 tRNA_Leu_1 IGR465 IGR462 IGR466 IGR468 IGR463 IGR461 IGR464 IGR467 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0582 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 CPn0590 CPn0593 CPn0585 CPn0592 CPn0591 CPn0582 CPn0587 CPn0589 atoS, - CPn0584 atoC, - CPn0586 CPn0590 CPn0593 CPn0585 CPn0591 CPn0582 CPn0589 atoS, - CPn0584 atoC, - CPn0586 CPn0583 CPn0588 CPn0587 CPn0583 CPn0592 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0586

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atoC  

Definition:
two-component sensor system regulatory subunit (ATOC-like, NTRC-like)

Gene Start:
676026

Gene Stop:
677186

Gene Length:
1161

Molecular Weight*:
43059

pI*:
6.50

Net Charge*:
-3.99

EC:
 

Functional Class:
regulatory functions  

Pathway: pathway table

Comment:
AtoC is a member of the two-component regulatory system AtoS/AtoC involved in the transcriptional regulation of the ato genes for acetoacetate metabolism. Also an inhibitor of polyamine biosynthesis.
Probable cytoplasmic location. Has potential to be phosphorylated by AtoS.

The N-terminal region is similar to that of other regulatory components of sensory transduction systems.

Blast Summary:  PSI-Blast Search
CPn0586 is orthologously related to CT468: residues 1-385 of CPn0586 are 67% similar to residues 1-385 of CT468, a predicted two-component sensor system regulator.
CPn0586 is also similar to TP0519, TP0082.

COGS Summary:  COGS Search
BeTs to 7 clades of COG2204
COG name: AAA superfamily ATPases with N-terminal receiver domain
Functional Class: T
The phylogenetic pattern of COG2204 is -----Q--E---uj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 166-209, 228-282, 293-320, 355-364 are significantly matched to blocks BL00675A, B, C, and D, which encompass the Sigma-54 interaction domain proteins' ATP-binding region A, as seen in FLBD_CAUCR, FLBD_CAUCR, NTRC_RHIME, and ATOC_ECOLI.
Residues 49-62 and 97-106 are significantly matched to blocks PF00072A and B, which encompass the response regulator receiver domain as seen in NTRC_RHOCA and ARCA_HAEIN.


ProDom Summary:  Protein Domain Search
Residues 7-105 are 44% similar to a region in PILR_PSEAE, defined as: PROTEIN TRANSDUCTION SENSORY PHOSPHORYLATION TRANSCRIPTION REGULATION REGULATORY DNA-BINDING REGULATOR ACTIVATOR.
Residues 245-383 are 51% similar to residues 298-435 of O66591_AQUAE, defined as: PROTEIN ACTIVATOR REGULATION DNA-BINDING TRANSCRIPTION ATP-BINDING REGULATORY TRANSCRIPTIONAL NITROGEN FIXATION; most frequently called NifA, NtrC or HoxA.
Residues 142-251 are 55% similar to the aa region 325-457 in HYFR_ECOLI, defined as: PROTEIN ACTIVATOR REGULATION DNA-BINDING TRANSCRIPTION ATP-BINDING REGULATORY NITROGEN TRANSCRIPTIONAL FIXATION; protein is most frequently called NifA, NtrC or DctD.
Residues 126-202 are 25% similar to the residues 43-124 of O57864_PYRHO, defined as: PROTEIN CELL DIVISION ATP-BINDING REPLICATION CONTROL ORIGIN RECOGNITION COMPLEX DNA.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 123 (E-value = 4.6e-37) place CPn0586 in the Response_reg family which is described as Response regulator receiver domain (PF00072)
Residues 142 to 363 (E-value = 2.8e-126) place CPn0586 in the Sigma54_activat family which is described as Sigma-54 interaction domain (PF00158)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
200  
295

PDB Hit:


Gene Protein Sequence:
MAIKNILVVDDEPLLRDFLSELLTSQGFIPDTAENLRNALQMIRSRDYDL
VISDMSMPDGSGLDLIKIIKQSSPHTPVLVVTAYGSIENAVEAMHQGAFN
YLTKPFSSEALFAFISKAEELKNLVHENLFLHSQTTPDSHPLIAESKAMK
DLLAIAKKAASSSANIFIHGESGCGKEVLSFFIHHNSPRANHPYIKVNCA
AIPETLLESELFGHEKGAFTGATTKKAGRFELAHKGTLLLDEITEVPVNL
QAKLLRAIQEKEIEHLGGTKTLSVDVRILATSNRKLKEAIDDKSFRQDLY
YRLNVIPLHLPPLRDRQDDILPLANYFLNKFCRMNNTPLKTLSPKAQELL
LNYPWPGNIRELSNVLERVVILENTSLLTEDMLALA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGATTAAAAATATACTTGTTGTTGATGACGAGCCCCTACTCAGAGA
TTTCCTCTCGGAACTTCTTACCTCACAGGGATTCATCCCAGACACTGCTG
AAAACTTAAGAAATGCTCTCCAAATGATCCGAAGTCGAGACTATGACCTT
GTCATCTCAGACATGAGTATGCCTGACGGCTCTGGTCTTGATTTAATCAA
AATTATAAAGCAAAGCTCCCCCCACACGCCCGTCCTTGTAGTCACTGCTT
ACGGAAGCATAGAGAACGCCGTAGAGGCTATGCACCAAGGGGCATTCAAC
TACTTAACAAAACCTTTTTCTTCTGAAGCACTTTTTGCCTTTATCTCTAA
AGCTGAAGAACTTAAGAACCTAGTCCATGAGAATCTCTTTCTACATTCTC
AGACAACACCAGATTCACACCCTCTGATTGCAGAAAGCAAGGCTATGAAA
GATCTTCTTGCCATAGCAAAAAAAGCAGCTTCAAGCTCAGCAAATATATT
CATTCACGGAGAATCGGGATGCGGAAAGGAAGTCCTCTCCTTTTTTATCC
ACCACAACTCTCCTCGAGCCAACCACCCCTATATTAAAGTTAACTGCGCA
GCAATTCCTGAAACTCTCTTAGAATCAGAACTTTTTGGCCATGAAAAGGG
AGCATTTACAGGAGCAACTACAAAGAAGGCAGGACGTTTTGAACTTGCCC
ATAAAGGAACCCTCTTATTAGATGAAATCACCGAAGTCCCAGTAAACCTT
CAAGCAAAACTCCTGAGAGCTATCCAAGAAAAAGAAATCGAACACCTTGG
AGGAACCAAGACCCTCTCCGTAGATGTTCGCATCTTAGCGACCTCAAACC
GAAAGCTTAAAGAAGCTATCGATGATAAAAGCTTCCGACAAGATCTGTAT
TACCGGTTGAATGTCATCCCTCTACACCTCCCCCCTCTAAGAGACCGACA
GGACGACATCCTCCCTCTGGCGAACTACTTCCTAAATAAGTTCTGCCGCA
TGAACAATACTCCTCTGAAAACCCTCTCTCCTAAAGCTCAAGAGCTCCTC
CTTAACTACCCCTGGCCAGGCAATATTCGAGAGCTCTCCAATGTTCTGGA
ACGTGTGGTTATCCTAGAGAACACCTCCCTACTCACCGAAGACATGCTCG
CTTTAGCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy