Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_1 IGR465 IGR462 IGR460 IGR466 IGR463 IGR461 IGR464 CPn0590 CPn0581 CPn0585 CPn0582 CPn0587 CPn0589 truA, - CPn0580 atoS, - CPn0584 atoC, - CPn0586 CPn0590 CPn0581 CPn0585 CPn0582 CPn0587 CPn0589 truA, - CPn0580 atoS, - CPn0584 atoC, - CPn0586 CPn0590 CPn0581 CPn0585 CPn0582 CPn0589 truA, - CPn0580 atoS, - CPn0584 atoC, - CPn0586 CPn0583 CPn0588 ygbP,yacM, - CPn0579 CPn0583 CPn0587 ygbP,yacM, - CPn0579 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0585

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
675817

Gene Stop:
673862

Gene Length:
1956

Molecular Weight*:
75661

pI*:
4.80

Net Charge*:
-33.16

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits to myosin heavy chains or paramyosins; e.g., residues 298-650 are 21% similar to the myosin heavy chain (U91585) of Girardia tigrina, residues 226-609 are 25% similar to the paramyosin (X08068) of Caenorhabditis elegans, and residues 216-617 are 21% similar to the myosin heavy chain IIxd (AF111785.1) of human. CPn0585 is also similar to Orf73 (containing large complex repeat CR 730) of human herpesvirus 8 (U93872.1).

CPn0585 is weakly similar to MG218 and MG328 in M. genitalium, MP0526 in M. pneumonium, and TP0408 in T. pallidum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1196
COG name: Chromosome segregation ATPases
Functional Class:  D
The phylogenetic pattern of COG1196 is am-kYqvc-br---gpol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 167-645 are 22% similar to a reticulocyte binding protein domain (84-1377) of RBP1_PLAVB.

Residues 199-594 are 22% similar to a cell division protein MukB domain (430-1467) of MUKB_ECOLI.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae. However, CPn0585 is weakly similar to CPn1054 and CPn0662, both hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
54  
72
transmembrane  
78  
98
non-globular  
106  
218
coil-coil  
227  
282
coil-coil  
299  
347
coil-coil  
358  
424
coil-coil  
435  
508
coil-coil  
526  
602
coil-coil  
613  
651

PDB Hit:
None

Gene Protein Sequence:
MATPAQKSPTFQDPSFVRELGSNHPVFSPLTLEERGEMAIARVQQCGWNH
TIVKVSLIILALLTILGGGLLVGLLPAVPMFIGTGLIALGAVIFALALIL
CLYDSQGLPEELPPVPEPQQIQIEDLRNETREVLEGTLLEVLLKDRDAKD
PAVPQVVVDCEKRLGMLDRKLRREEEILYRSTAHLKDEERYEFLLELLEM
RSLVADRLEFNRRSYERFVQGIMTVRSEEGEKEISRLQDLISLQQQTVQD
LRSRIDDEQKRCWTALQRINQSQKDIQRAHDREASQRACEGTEMDCAERQ
QLEKDLRRQLKSMQEWIEMRGTIHQQEKAWRKQNAKLERLQEDLRLTGIA
FDEQSLFYREYKEKYLSQKLDMQKILQEVNAEKSEKACLESLVHDYEKQL
EQKDANLKKAAAVWEEELGKQQQEDYEQTQEIRRLSTFILEYQDSLREAE
KVEKDFQELQQRYSRLQEEKQVKEKILEESMNHFADLFEKAQKENMAYKK
KLADLEGAAAPTEIGEDDDWVLTDSASLSQKKIRELVEENQELLKALAFK
SNELTQLVADAVEAEKEISKLREHIEEQKEGLRALDKMHAQAIKDCEAAQ
RKCCDLESLLSPVREDAGMRFELEVELQRLQEENAQLRAEVERLEQEQFQ
G$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACACCCGCTCAAAAATCCCCTACATTTCAAGATCCTAGTTTTGT
AAGAGAGCTAGGCAGTAACCACCCTGTCTTTTCCCCGCTAACGCTTGAGG
AAAGAGGGGAGATGGCAATAGCTCGAGTCCAGCAGTGTGGATGGAATCAT
ACAATTGTTAAGGTAAGTCTTATTATTCTTGCTCTTCTTACTATTTTAGG
GGGAGGATTACTCGTAGGATTGCTGCCAGCAGTTCCTATGTTTATTGGAA
CAGGTCTGATTGCTTTGGGAGCCGTTATATTTGCTTTGGCTTTGATTTTA
TGTCTTTATGATTCTCAGGGCCTTCCTGAGGAACTCCCTCCGGTTCCTGA
ACCACAACAAATTCAGATTGAAGATTTAAGAAACGAGACCAGAGAAGTTC
TTGAAGGGACTCTTTTAGAGGTTCTCTTAAAGGATAGAGACGCTAAGGAC
CCTGCGGTGCCCCAGGTGGTTGTAGACTGTGAAAAGCGTCTTGGAATGTT
GGATCGTAAGCTGCGACGTGAAGAGGAGATTCTGTATCGCTCGACGGCCC
ATCTTAAAGACGAGGAAAGGTATGAGTTCTTGCTGGAGCTCTTGGAAATG
CGTAGTCTGGTTGCCGATCGGCTAGAATTTAACCGTAGAAGTTATGAGCG
ATTTGTTCAAGGAATTATGACAGTTAGATCAGAGGAGGGGGAAAAAGAGA
TTTCTCGTCTACAAGATCTAATCAGTTTGCAGCAGCAGACGGTGCAAGAT
TTAAGGAGTCGGATCGATGACGAGCAGAAGAGATGCTGGACGGCTTTACA
ACGTATTAACCAATCTCAGAAGGATATACAACGGGCTCATGATCGCGAGG
CTTCGCAGCGTGCCTGTGAGGGCACAGAGATGGATTGTGCAGAACGCCAG
CAACTGGAGAAGGATTTAAGGAGACAGCTGAAATCTATGCAGGAGTGGAT
TGAGATGAGGGGCACAATCCATCAACAAGAGAAGGCTTGGCGTAAGCAGA
ATGCCAAATTAGAAAGATTACAAGAGGATCTGAGACTTACTGGGATTGCT
TTTGACGAACAATCTCTGTTCTATCGCGAATATAAAGAGAAATATCTGAG
TCAGAAACTAGATATGCAAAAGATTTTACAGGAAGTCAACGCAGAGAAAA
GTGAGAAGGCTTGCTTAGAGAGTCTGGTCCATGACTATGAGAAGCAGCTC
GAACAAAAAGATGCTAATCTGAAGAAAGCAGCAGCTGTTTGGGAAGAAGA
ATTAGGGAAGCAGCAACAGGAAGACTACGAACAAACCCAAGAAATTAGAC
GTCTGAGTACATTCATTCTTGAGTACCAGGACAGTCTGCGTGAGGCAGAA
AAAGTTGAGAAAGATTTCCAAGAGCTACAACAAAGGTATAGCCGTCTTCA
AGAGGAGAAACAGGTAAAAGAAAAAATCTTAGAAGAAAGTATGAATCATT
TTGCCGATCTCTTTGAGAAGGCTCAAAAGGAAAACATGGCCTACAAGAAG
AAGTTAGCGGATTTAGAGGGTGCCGCTGCTCCTACTGAGATCGGTGAGGA
CGATGACTGGGTACTCACAGATTCTGCTTCTCTCAGCCAGAAGAAGATCC
GCGAACTCGTGGAAGAGAATCAAGAACTCCTGAAAGCACTTGCATTTAAA
TCTAACGAATTGACTCAACTGGTTGCCGATGCTGTAGAAGCTGAAAAAGA
AATCAGCAAGCTTCGAGAACACATAGAAGAGCAGAAAGAAGGATTACGAG
CTCTTGATAAGATGCATGCACAAGCGATCAAAGATTGCGAAGCTGCTCAG
AGAAAATGCTGTGACCTTGAGAGCCTTCTCTCTCCTGTTCGAGAAGATGC
TGGAATGAGATTTGAGCTAGAGGTCGAGCTTCAAAGATTGCAAGAAGAAA
ATGCACAGCTTAGAGCGGAGGTTGAAAGACTAGAGCAAGAGCAATTTCAA
GGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy