Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_1 IGR462 IGR460 IGR463 IGR461 IGR459 IGR464 CPn0581 CPn0585 CPn0582 CPn0587 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 CPn0585 CPn0582 CPn0587 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 CPn0585 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0583 CPn0588 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579 CPn0587 CPn0588
* Calculated from Protein Sequence

Gene ID: CPn0584

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atoS  

Definition:
two-component sensor histidine kinase (ATOS-related)

Gene Start:
672707

Gene Stop:
673801

Gene Length:
1095

Molecular Weight*:
40485

pI*:
7.50

Net Charge*:
1.28

EC:
2.7.3.-  

Functional Class:
regulatory functions  

Pathway: pathway table
signal transduction; two-component system

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to two-component sensor histidine kinase sequences; e.g. residues 2-352 are 31% similar to (AE001790) sensor histidine kinase [Thermotoga maritima]; residues 33-351 are 25% similar to ATOS_ECOLI; residues 139-349 are 33% similar to HYDH_ECOLI; residues 15-349 are 63% similar to CT467; and residues 112-351 are 30% similar to TP0520.

CPn0584 is orthologously related to CT467: residues 15-349 of CPn0584 are 63% similar to residues 15-348 of CT467, two-component sensor histidine kinase (ATOS-related) from C. trachomatis.


COGS Summary:  COGS Search
BeTs to 13 clades of COG0642
COG name: Sensory transduction histidine kinases
Functional Class:  T
The phylogenetic pattern of COG0642 is AMT-YQVCEBRHUJ--O-inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 304-314 and 315-333 represent blocks PR00344B-C (BACTERIAL SENSOR PROTEIN C-TERMINAL SIGNATURE) with a combined E-value of 1.3e-09.

ProDom Summary:  Protein Domain Search
Residues 242-349 are 39% similar to a defined domain of HYDH_ECOLI, defined as: KINASE PROTEIN SENSORY TRANSDUCTION TRANSFERASE HISTIDINE PHOSPHORYLATION SENSOR TRANSMEMBRANE PHYTOCHROME.
Residues 147-212 are 37% similar to a defined domain of ATOS_ECOLI, defined as: KINASE PROTEIN SENSORY TRANSDUCTION TRANSFERASE PHOSPHORYLATION SENSOR TRANSMEMBRANE PHYTOCHROME HISTIDINE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 151 to 216 (E-value = 3.9e-17) place CPn0584 in the HisKA family which is described as His Kinase A (phosphoacceptor) domain (PF00512)
Residues 255 to 354 (E-value = 3.8e-22) place CPn0584 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)

PDB Hit:


Gene Protein Sequence:
MNVPDSKNLHPPAYELLEIKARITQSYKEASAILTAIPDGILLLSETGHF
LICNSQAREILGIDENLEILNRSFTDVLPDTCLGFSIQEALESLKVPKTL
RLSLCKESKEKEVELFIRKNEISGYLFIQIRDRSDYKQLENAIERYKNIA
ELGKMTATLAHEIRNPLSGIVGFASILKKEISSPRHQRMLSSIISGTRSL
NNLVSSMLEYTKSQPLNLKIINLQDFFSSLIPLLSVSFPNCKFVREGAQP
LFRSIDPDRMNSVVWNLVKNAVETGNSPITLTLHTSGDISVTNPGTIPSE
IMDKLFTPFFTTKREGNGLGLAEAQKIIRLHGGDIQLKTSDSAVSFFIII
PELLAALPKERAAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGTCCCTGATTCCAAGAACCTCCATCCTCCTGCATACGAACTCCT
AGAGATCAAGGCTCGCATCACACAATCTTATAAAGAAGCGAGTGCTATAC
TGACAGCGATTCCTGATGGTATCCTATTACTTTCTGAAACAGGACACTTT
CTTATCTGCAATTCACAAGCACGTGAAATTCTAGGAATTGATGAAAATCT
AGAAATTCTTAATAGATCCTTTACCGATGTTCTCCCCGATACGTGTCTTG
GATTTTCTATTCAAGAGGCTCTTGAATCTCTAAAAGTCCCTAAAACTCTT
AGACTCTCTCTCTGTAAAGAATCTAAAGAAAAAGAAGTGGAACTCTTCAT
CCGTAAAAACGAGATCAGTGGATACCTGTTTATCCAAATCCGCGATCGGT
CCGACTATAAACAACTAGAAAACGCTATAGAAAGATATAAAAATATCGCA
GAACTTGGGAAAATGACGGCTACCCTAGCTCACGAAATCCGCAATCCGCT
AAGTGGAATCGTTGGATTTGCCTCTATCCTAAAGAAAGAGATTTCCTCTC
CTCGCCACCAACGAATGCTCTCCTCAATCATCTCCGGCACAAGGTCTCTA
AATAACCTTGTCTCTTCTATGTTAGAATATACAAAATCACAACCGTTGAA
CCTAAAGATTATAAATTTACAAGACTTCTTCTCTTCTCTTATCCCTCTGC
TCTCCGTCTCTTTCCCGAATTGCAAGTTTGTAAGAGAGGGCGCACAACCT
CTATTCAGATCTATAGATCCTGATCGGATGAACAGTGTCGTTTGGAACCT
AGTGAAAAATGCTGTAGAAACAGGGAACTCTCCGATCACTCTGACCCTGC
ATACATCGGGAGACATCTCGGTAACGAACCCCGGAACGATTCCTTCCGAG
ATCATGGACAAGCTCTTCACTCCATTCTTCACAACAAAGAGAGAGGGAAA
TGGTTTGGGACTTGCTGAAGCTCAAAAAATTATAAGACTCCATGGAGGAG
ATATCCAATTAAAAACAAGCGACTCCGCCGTTAGCTTCTTCATAATCATC
CCCGAACTTCTAGCGGCCCTACCCAAAGAAAGAGCCGCTAGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy