Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_2 tRNA_Leu_1 IGR462 IGR460 IGR463 IGR461 IGR459 IGR464 IGR458 CPn0581 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 CPn0587 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 CPn0587 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 CPn0587 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0583 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0583

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
672400

Gene Stop:
672720

Gene Length:
321

Molecular Weight*:
12560

pI*:
8.40

Net Charge*:
1.19

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0583 is orthologously related to CT466: residues 1-105 of CPn0583 are 62% similar to residues 1-105 of CT466, a predicted Chlamydia-specific hypothetical protein (basic) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
46
coil-coil  
49  
106

PDB Hit:


Gene Protein Sequence:
MNERTLLLLLKKKKGLFLAILDLTQTESSLTTPELEKVLKQKKIFLSCID
RVDLQIKEFRHAFSSELPQDIQEELEEIRDVIIRILDTDKRNYAQKKKEF
GIYERP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAAAGAACCCTCTTGCTCTTGTTAAAAAAGAAGAAGGGCCTTTT
CCTTGCTATTTTAGATCTTACGCAAACAGAATCCTCTCTAACGACTCCAG
AATTAGAGAAAGTCTTAAAGCAAAAAAAAATCTTTCTTTCTTGCATCGAT
AGAGTTGATCTTCAAATCAAAGAGTTTCGCCATGCCTTCTCTTCCGAACT
TCCCCAAGATATCCAAGAAGAGCTGGAAGAAATCCGTGATGTTATTATTC
GTATTCTAGATACGGATAAACGCAACTATGCACAGAAAAAAAAGGAATTT
GGTATTTATGAACGTCCCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy