Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_1 IGR462 IGR460 IGR463 IGR461 IGR459 IGR458 CPn0581 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0581 prfB, - CPn0576 CPn0585 CPn0575 CPn0575 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 atoC, - CPn0586 CPn0583 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0581

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phosphoglycolate phosphatase)

Gene Start:
671434

Gene Stop:
670742

Gene Length:
693

Molecular Weight*:
26738

pI*:
5.00

Net Charge*:
-7.98

EC:
 

Functional Class:
unknown  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0581 is orthologously related to CT464: residues 1-225 of CPn0581 are 44% similar to residues 1-226 of CT464, a predicted conserved hypothetical protein (acidic)(possible phosphoglycolate phosphatase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0637
COG name: Predicted phosphatase/phosphohexomutase
Functional Class:  R
The phylogenetic pattern of COG0637 is ---kY-vcEbRh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 195 (E-value = 1.8e-21) place CPn0581 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

PDB Hit:


Gene Protein Sequence:
MYLEDYDVFFFDLDGLLVDTEPCFYRAFLQACAEFSLEVHWDFSTYYSHT
TLGTEIFSKKFIEQYPQAQEYMAEIFAKRLQIYYKSLEHAGPALMPGVEA
FIELVLSLNKTFGVVTNSPRDATHTLRTMYPILNKFLFWVTRENYARPKP
YGDSYDYAYRTFAREGMKVIGFEDSVKGLRALSKIPATLVCINSMAEITP
EDYPELKGKEFFSYPSFDVLTEHCSQQKLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTTAGAGGATTATGACGTTTTCTTTTTTGATTTAGATGGTTTGCT
TGTAGATACAGAACCTTGTTTTTATCGTGCATTTTTACAAGCCTGTGCTG
AATTTTCTTTAGAAGTGCATTGGGATTTTTCTACCTATTATAGTCATACT
ACCTTAGGAACAGAAATTTTTAGCAAAAAGTTTATAGAACAATATCCCCA
AGCACAAGAGTACATGGCGGAGATCTTTGCAAAACGACTGCAGATTTACT
ACAAGTCCTTAGAACACGCAGGTCCTGCTCTGATGCCTGGAGTCGAAGCT
TTCATCGAGCTTGTCTTGTCTTTGAATAAAACATTTGGAGTTGTAACTAA
CTCTCCAAGAGATGCCACGCACACACTACGTACTATGTATCCAATTTTAA
ATAAATTTTTGTTCTGGGTCACCCGAGAAAATTATGCACGCCCTAAGCCT
TACGGAGATAGTTATGACTACGCGTATCGGACGTTTGCTCGTGAAGGAAT
GAAAGTTATAGGATTTGAAGATTCTGTGAAGGGGCTTCGGGCGCTCTCCA
AGATTCCAGCAACTTTAGTATGTATCAATTCGATGGCGGAGATCACCCCT
GAAGATTACCCTGAACTTAAAGGCAAAGAATTTTTCTCTTATCCTTCGTT
TGACGTGCTAACAGAGCATTGCTCACAACAGAAGTTATTGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy