Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_1 IGR457 IGR462 IGR460 IGR461 IGR459 IGR458 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0581 prfB, - CPn0576 CPn0585 CPn0575 CPn0574 CPn0573 CPn0574 CPn0575 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0583 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0580

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
truA  

Definition:
truA, pseudouridylate synthase I

Gene Start:
669993

Gene Stop:
670796

Gene Length:
804

Molecular Weight*:
29774

pI*:
8.50

Net Charge*:
6.36

EC:
4.2.1.70  5.4.99.12  

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
This enzyme is responsible for the formation of pseudouridine in the anticodon stem of
tRNAs.

Blast Summary:  PSI-Blast Search
CPn0580 is orthologously related to CT463: residues 3-255 of CPn0580 are similar to residues 4-256 of CT463, a predicted pseudouridylate synthetase from C. trachomatis.
CPn0580 is also similar to TP0830, UU536, MG182.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0101
COG name: Pseudouridylate synthase (tRNA psi55)
Functional Class:  J
The phylogenetic pattern of COG0101 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 107 (E-value = 8e-33) place CPn0580 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)
Residues 146 to 248 (E-value = 5.5e-33) place CPn0580 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)

PDB Hit:


Gene Protein Sequence:
MTKVALLIAYQGTAYSGWQQQPNDLSIQEVIESSLKKITKTRTPLIASGR
TDAGVHAYGQVAHFRAPDHPLFANANLTKKALNAILPKDIVIRDVALFDD
NFHARYLAIAKEYRYSLSRLAKPLPWQRHFCYTPRHPFSTELMQEGANLL
IGTHDFASFANHGRDYNSTVRTIYTLDIVDKGDSLSIICRGNGFLYKMVR
NLVGALLDVGKGAYPPEHLLDILEQKNRREGPSAAPAYGLSLHHVCYSSP
YNNFCCEQCSVSTSNEG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAAGTAGCTCTTCTTATTGCTTATCAAGGAACTGCCTATTCAGG
CTGGCAACAACAACCGAATGACCTATCGATTCAGGAGGTTATTGAAAGTT
CCCTAAAGAAAATTACTAAAACTCGCACTCCACTAATTGCCTCTGGGAGA
ACCGACGCAGGCGTCCATGCCTACGGGCAAGTGGCGCATTTCCGAGCTCC
TGATCACCCTCTATTTGCAAACGCGAACCTTACAAAAAAAGCCCTCAATG
CGATTCTCCCTAAAGATATTGTAATCAGAGATGTTGCTTTGTTTGATGAT
AATTTCCATGCACGCTATCTTGCCATTGCTAAAGAATATCGTTATTCCCT
ATCAAGACTTGCCAAACCTCTTCCCTGGCAGCGCCATTTCTGTTATACCC
CTCGCCACCCTTTTTCTACAGAGCTCATGCAGGAAGGTGCGAACCTGCTT
ATAGGAACTCATGACTTTGCCTCTTTTGCAAATCATGGCAGGGACTATAA
CTCTACAGTACGAACGATCTATACCCTGGATATTGTAGATAAAGGAGATT
CTCTCTCCATAATATGCAGAGGAAATGGCTTCCTTTATAAGATGGTACGG
AATCTTGTAGGAGCCCTTTTAGATGTGGGGAAAGGAGCGTATCCACCTGA
ACATCTCCTAGATATCTTAGAACAGAAAAATCGTAGAGAAGGACCTTCGG
CGGCTCCTGCCTACGGCCTTTCTTTACACCACGTATGCTATTCCTCTCCC
TACAATAACTTCTGTTGTGAGCAATGCTCTGTTAGCACGTCAAACGAAGG
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy