Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_1 IGR457 IGR462 IGR460 IGR456 IGR461 IGR459 IGR458 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0583 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0579

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ygbP  yacM  

Definition:
probable sugar phosphorylase (YgbP-like, YacM-like)

Gene Start:
669361

Gene Stop:
669996

Gene Length:
636

Molecular Weight*:
23432

pI*:
6.40

Net Charge*:
-1.89

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0579 is orthologously related to CT462: residues 2-211 of CPn0579 are 58% similar to residues 3-212 of CT462, a predicted sugar phosphorylase (YgbP-like, YacM-like) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1211
COG name: 4-diphosphocytidyl-2-methylerithritol synthase
Functional Class:  I
The phylogenetic pattern of COG1211 is ---k-qvcebrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 211 (E-value = 6.6e-26) place CPn0579 in the IspD family which is described as Uncharacterized protein family UPF0007 (PF01128)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
45

PDB Hit:


Gene Protein Sequence:
MIKSSLILLSGGQGTRFGSKIPKQYLPLNGTPLVLHSLKILSSLPQIAEV
IVVCDPSYQETFQEYPVSFAIPGERRQDSVFSGLQQVSYPWVIIHDGARP
FIYPDEIHDLLETAEKIGATALASPIPYTIKQRNPVRTLDRDNLAIIHTP
QCIKTEILREGLALAKEKQLTLVDDIEAAEIIGKPSQLVFNKHPQIKISY
PEDLTIAQALL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAGTCTTCTCTAATACTTCTTAGTGGAGGACAAGGTACACGTTT
TGGATCTAAAATTCCTAAGCAGTACCTCCCTCTAAATGGAACTCCCTTAG
TTCTTCACTCATTAAAGATACTCTCTTCTTTGCCACAAATTGCTGAGGTG
ATTGTTGTTTGCGACCCCTCATATCAAGAAACCTTTCAAGAATATCCTGT
CTCTTTTGCCATTCCTGGAGAGCGTCGCCAAGATTCTGTCTTTTCAGGAC
TACAGCAAGTCTCCTATCCCTGGGTAATCATCCACGATGGAGCACGTCCT
TTTATCTATCCCGACGAAATTCATGATTTATTAGAAACAGCAGAAAAGAT
CGGGGCGACAGCTCTAGCGTCTCCGATTCCCTATACCATAAAACAACGCA
ATCCTGTGCGCACTCTGGACCGAGACAATTTAGCAATAATTCATACCCCT
CAGTGTATAAAAACGGAAATCCTCAGAGAGGGTCTAGCTCTTGCAAAAGA
AAAACAGCTCACACTGGTAGACGACATCGAAGCTGCTGAAATCATAGGCA
AACCCTCGCAACTCGTTTTCAATAAGCATCCTCAAATCAAAATTTCCTAC
CCCGAAGATCTAACGATTGCCCAAGCCCTCCTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy