Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_1 IGR457 IGR462 IGR460 IGR456 IGR461 IGR459 IGR458 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 CPn0585 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0572 CPn0583 ygbP,yacM, - CPn0579 CPn0583 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0578

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phosphohydrolase yaeI)

Gene Start:
668406

Gene Stop:
669368

Gene Length:
963

Molecular Weight*:
36366

pI*:
9.90

Net Charge*:
12.84

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible calcineurin-like phosphohydrolase (yaeI). See CPn0897.

Blast Summary:  PSI-Blast Search
CPn0578 is orthologously related to CT461: residues 3-320 of CPn0578 are 56% similar to residues 7-328 of CT461, a predicted conserved hypothetical protein (basic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1408
COG name: Predicted phosphohydrolases
Functional Class:  R
The phylogenetic pattern of COG1408 is --t--q--eBr-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 45 to 254 (E-value = 8.9e-23) place CPn0578 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
173  
205

PDB Hit:


Gene Protein Sequence:
VLISISLATLPILAFSWASFIEPNWLRTTAIPWRLPKKHAHLHGLRIAQI
SDLHFHKRVPEKFLNKVSKSIKNFSPDLIVFCGDLLCRARLEDKERLETF
LNTLEAPLGVFAILGNHDYSSYISRNTKGEITCIPEEKSRPIQRAIIAVM
QGLFSSPSYRYDPNLTPQEPHPDLLKLLKNTPLTLLHNTTHVIPNTLNIV
GLGDLFARQFHPEQAFKNYDPSLPGLLLSHNPDGITRLQQYPGDFVLSGH
SHGPQVTLSWPKFARKFFERLSGLENPYLARGYFVTKEGKQLYVNRGLGG
LKRIRFCSPPEICYITCSYD$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTATCTCTATTTCTTTAGCCACCCTTCCTATTCTTGCCTTTTCTTG
GGCTTCCTTCATTGAACCGAATTGGTTAAGAACAACTGCTATTCCATGGA
GGCTTCCAAAAAAACATGCGCATTTGCATGGTCTTCGCATCGCTCAGATT
TCGGATCTCCATTTCCATAAGAGAGTTCCTGAGAAATTTCTTAATAAAGT
TTCCAAATCAATAAAAAATTTCTCTCCCGATCTTATTGTATTTTGTGGTG
ACCTCCTTTGCCGTGCTCGACTTGAAGATAAGGAACGACTTGAAACCTTC
CTAAATACATTAGAAGCTCCTCTAGGAGTCTTTGCTATTCTAGGCAATCA
CGACTATTCTTCGTATATTTCCAGAAACACTAAAGGAGAGATTACCTGTA
TCCCTGAGGAAAAAAGTCGTCCTATACAACGCGCCATCATTGCTGTAATG
CAAGGGCTATTCTCCTCTCCTAGCTATCGCTATGATCCCAATCTGACTCC
CCAAGAGCCCCACCCAGACCTCTTAAAACTTCTGAAGAATACTCCCCTAA
CTCTCCTTCACAATACCACGCATGTCATTCCTAACACTCTTAATATTGTA
GGACTTGGGGATCTGTTCGCTAGACAATTCCATCCTGAACAGGCATTCAA
AAACTATGATCCTTCTCTCCCAGGCCTTCTCCTTTCTCATAATCCTGATG
GCATAACTAGGCTGCAACAATACCCTGGAGATTTTGTACTTTCAGGACAT
TCCCACGGTCCACAAGTTACTTTGTCCTGGCCGAAGTTTGCTCGAAAATT
CTTTGAAAGGCTGTCAGGATTAGAAAATCCCTATCTTGCACGCGGGTATT
TCGTTACTAAGGAAGGAAAACAACTCTACGTAAACCGCGGTCTCGGCGGA
CTAAAAAGAATTCGCTTCTGCTCCCCTCCTGAAATCTGCTACATCACATG
TTCCTATGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy