Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Leu_1 IGR457 IGR460 IGR456 IGR461 IGR459 IGR458 CPn0581 CPn0573 prfB, - CPn0576 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 CPn0577 CPn0582 truA, - CPn0580 CPn0578 atoS, - CPn0584 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 CPn0582 truA, - CPn0580 CPn0578 CPn0572 CPn0583 ygbP,yacM, - CPn0579 ygbP,yacM, - CPn0579 atoS, - CPn0584 CPn0583
* Calculated from Protein Sequence

Gene ID: CPn0577

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
SwiB (YM74) complex protein

Gene Start:
667895

Gene Stop:
668158

Gene Length:
264

Molecular Weight*:
9863

pI*:
10.70

Net Charge*:
8.65

EC:
 

Functional Class:

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0577 is orthologously related to CT460 and they
share 72% similarity. CPn0577 is also similar to
CT643, a predicted DNA topoisomerase I: residues 17-87 are 47% similar to residues 786-855 of CT643.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0133
COG name: Tryptophan synthase beta chain
Functional Class:  E
The phylogenetic pattern of COG0133 is amtkyqVcEbrhuj----i--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0577 is similar to CPn0769, a predicted DNA topoisomerase I-fused to SWI domain:residues 17-87 are 49% similar to residues 792-861 of CPn0769.

Pfam Summary:  Pfam Search
Residues 10 to 86 (E-value = 1.8e-38) place CPn0577 in the SWIB family which is described as SWIB/MDM2 domain (PF02201)

PDB Hit:


Gene Protein Sequence:
MSQKNKNSAFMHPVNISTDLAVIVGKGPMPRTEIVKKVWEYIKKHNCQDQ
KNKRNILPDANLAKVFGSSDPIDMFQMTKALSKHIVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTCAAAAAAATAAAAACTCTGCTTTTATGCATCCCGTGAATATTTC
CACAGATTTAGCAGTTATAGTTGGCAAGGGACCTATGCCCAGAACCGAAA
TTGTAAAGAAAGTTTGGGAATACATTAAAAAACACAACTGTCAGGATCAA
AAAAATAAACGTAATATCCTTCCCGATGCGAATCTTGCCAAAGTCTTTGG
CTCTAGTGATCCTATCGACATGTTCCAAATGACCAAAGCCCTTTCCAAAC
ATATTGTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy