Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR457 IGR456 IGR455 IGR459 IGR458 CPn0581 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 CPn0572 CPn0581 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 truA, - CPn0580 CPn0578 CPn0572 ygbP,yacM, - CPn0579 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0575

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein(YhhY related acetyltransferase?)

Gene Start:
666494

Gene Stop:
665979

Gene Length:
516

Molecular Weight*:
19588

pI*:
9.60

Net Charge*:
3.20

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible acetyltransferase (yhhY).

Blast Summary:  PSI-Blast Search
CPn0575 is orthologously related to CT458: residues 13-171 of CPn0575 are 79% similar to residues 9-167 of CT458, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0454
COG name: Predicted acetyltransferases
Functional Class:  R
The phylogenetic pattern of COG0454 is AmTKYqVCEBR-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 64 to 146 (E-value = 5.3e-21) place CPn0575 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

PDB Hit:


Gene Protein Sequence:
MTAEKQNTGILGLEIRYTLPSDATYMLKWLNDPKILRGFPIQTEAEIRET
VNFWVGFYRYHSSLTAVYNGNVAGVATLVLNPYVKVSHHALISIIVGEEF
RNKGIGTALLNNLIHLAKTRFKLEVLYLEVYEGNPALHLYQRFGFVEVGR
QNRFYKDEIGYLAKTTMEKDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGCAGAAAAGCAAAATACAGGAATTCTAGGATTAGAAATACGGTA
CACTCTTCCTAGCGATGCAACGTATATGCTAAAATGGCTGAATGATCCTA
AAATTTTACGTGGATTTCCCATCCAAACGGAAGCAGAAATTCGTGAGACT
GTAAATTTCTGGGTAGGATTCTATCGTTATCATTCTAGCTTAACAGCTGT
GTACAATGGGAATGTTGCTGGAGTGGCAACTTTGGTTCTTAACCCTTATG
TTAAGGTTTCCCATCATGCGCTGATTTCCATTATTGTTGGAGAAGAGTTT
CGTAATAAAGGCATAGGGACCGCCTTGCTAAACAATCTTATTCATTTGGC
GAAGACGCGATTTAAGCTTGAGGTCCTCTATCTTGAAGTCTATGAGGGCA
ATCCTGCTCTGCATCTCTACCAACGTTTTGGATTTGTCGAAGTAGGAAGG
CAAAACCGTTTTTATAAAGATGAAATCGGCTATCTTGCTAAAACTACTAT
GGAAAAGGATCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy