Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR457 IGR456 IGR455 IGR459 IGR458 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 truA, - CPn0580 CPn0578 argS, - CPn0570 CPn0572 ygbP,yacM, - CPn0579 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0574

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
665945

Gene Stop:
665391

Gene Length:
555

Molecular Weight*:
22009

pI*:
10.80

Net Charge*:
17.58

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MVETVLHNFQRYLSKYLYRVFRFPCRKKTFLSSHRVLARPSFPVDYCPGK
IYDLQEIYEELNAQLFQGALRLQIGWFGRKATRKGKSVVLGLFHENEQLI
RIHRSLDRQEIPRFFMEYLVYHEMVHSVVPREYSLSGRSIFHGKKFKEYE
QRFPLYDRAVAWEKANAYLLRGYKKRVGGGYGRA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGAAACAGTACTTCATAATTTCCAACGTTATCTGAGCAAGTATCT
CTATAGGGTATTTCGCTTCCCATGTCGTAAAAAGACGTTCCTATCTTCGC
ACAGGGTTCTTGCTCGTCCTTCATTCCCAGTAGACTACTGTCCGGGAAAG
ATCTATGATTTGCAGGAGATCTATGAGGAATTGAATGCGCAGTTATTTCA
AGGTGCACTGCGTTTACAGATTGGTTGGTTCGGAAGGAAAGCTACCAGAA
AAGGCAAGAGTGTTGTCTTGGGATTGTTTCATGAAAATGAACAGTTAATT
CGAATTCATCGTTCTTTAGATCGGCAGGAAATCCCAAGATTTTTTATGGA
ATATCTTGTGTATCATGAAATGGTTCATAGTGTAGTCCCTAGAGAGTATT
CTCTATCGGGGCGTTCGATTTTTCATGGTAAAAAGTTTAAAGAATACGAA
CAACGTTTCCCCTTGTATGATCGTGCTGTTGCTTGGGAAAAGGCAAACGC
TTATTTATTGCGAGGGTATAAAAAAAGAGTAGGTGGAGGATATGGCAGGG
CATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy