Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR457 IGR456 IGR455 IGR459 IGR458 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 truA, - CPn0580 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0575 CPn0574 CPn0574 CPn0575 CPn0577 CPn0578 argS, - CPn0570 CPn0572 ygbP,yacM, - CPn0579 truA, - CPn0580 ygbP,yacM, - CPn0579
* Calculated from Protein Sequence

Gene ID: CPn0573

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (YEBC-related)

Gene Start:
665404

Gene Stop:
664688

Gene Length:
717

Molecular Weight*:
26457

pI*:
5.20

Net Charge*:
-6.96

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Predicted YebC family protein (yebC).

Blast Summary:  PSI-Blast Search
CPn0573 is orthologously related to CT457: residues 1-238 of CPn0573 are 79% similar to residues 1-238 of CT457, a predicted conserved hypothetical protein from C. trachomatis.
CPn0573 is also similar to TP0474, UU295, MG332, all predicted hypothetical proteins.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0217
COG name: Uncharacterized ACR, YebC family
Functional Class:  S
The phylogenetic pattern of COG0217 is ----yqvcEBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 238 (E-value = 1.6e-131) place CPn0573 in the DUF28 family which is described as Domain of unknown function DUF28 (PF01709)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
46  
79

PDB Hit:


Gene Protein Sequence:
MAGHSKWANTKHRKERADHKKGKIFSRIIKELISAVKLGGADPKSNARLR
MVIQKAKENNIPNENIERNLKKATSAEQKNFEEVTYELYGHGGVGIIVEA
MTDNKNRTASDMRIAINKRGGSLVEPGSVLYNFARKGACTVAKSSIDEEV
IFSYAIEAGAEDLDTEDEENFLVICAPSELASVKEKLISQGATCSEDRLI
YLPLRLVDCDEKDGEANLALIDWLEQIEDVDDVYHNMS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGGGCATAGTAAGTGGGCCAATACGAAACATCGCAAGGAAAGAGC
AGATCATAAAAAAGGCAAGATTTTTTCTCGTATTATTAAAGAGTTGATTT
CAGCTGTTAAATTAGGGGGAGCTGACCCTAAGTCCAATGCGCGATTACGT
ATGGTGATACAGAAAGCTAAGGAAAATAATATCCCTAATGAGAATATCGA
AAGGAATTTGAAGAAAGCAACTTCTGCAGAGCAAAAGAACTTTGAAGAGG
TTACCTATGAGCTGTATGGTCATGGGGGAGTGGGAATTATTGTGGAAGCA
ATGACGGATAACAAGAACCGTACGGCTTCTGATATGCGCATTGCTATAAA
TAAACGTGGAGGTTCTCTTGTAGAACCTGGAAGCGTACTTTATAATTTTG
CAAGGAAAGGGGCGTGTACTGTCGCTAAGAGCTCTATAGATGAAGAAGTA
ATATTTTCTTATGCTATAGAAGCAGGAGCTGAGGATCTCGATACCGAAGA
TGAAGAAAACTTCTTAGTGATCTGTGCTCCAAGTGAACTTGCCTCCGTTA
AAGAGAAACTTATCAGTCAGGGTGCGACTTGTAGTGAAGACAGGTTGATT
TATCTTCCCTTGCGTCTAGTAGATTGTGATGAGAAAGATGGCGAGGCAAA
CTTAGCTCTTATTGATTGGCTAGAGCAAATCGAAGATGTGGATGACGTCT
ACCACAACATGTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy