Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR457 IGR456 IGR455 IGR459 IGR458 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 plsC, - CPn0569 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0577 plsC, - CPn0569 CPn0578 argS, - CPn0570 CPn0572 CPn0573 prfB, - CPn0576 murA, - CPn0571 CPn0575 CPn0574 CPn0574 CPn0575 plsC, - CPn0569 CPn0578 argS, - CPn0570 CPn0572 CPn0577
* Calculated from Protein Sequence

Gene ID: CPn0572

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
662352

Gene Stop:
664619

Gene Length:
2268

Molecular Weight*:
77572

pI*:
6.00

Net Charge*:
-7.16

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0572 is similar to CT456: residues 108-657 of CPn0572 are 34% similar to residues 265-845 of CT456, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
170
non-globular  
316  
755

PDB Hit:


Gene Protein Sequence:
MAAPINQPSTTTQITQTGQTTTTTTVGSLGEHSVTTTGSGAAAQTSQTVT
LIADHEMQEIASQDGSAVSFSAEHSFSTLPPETGSVGATAQSAQSAGLFS
LSGRTQRRDSEISSSSDGSSISRTSSNASSGETSRAESSPDLGDLDSLSG
SERAEGAEGPEGPGGLPESTIPHYDPTDKASILNFLKNPAVQQKMQTKGG
HFVYVDEARSSFIFVRNGDWSTAESIKVSNAKTKENITKPADLEMCIAKF
CVGYETIHSDWTGRVKPTMEERSGATGNYNHLMLSMKFKTAVVYGPWNAK
ESSSGYTPSAWRRGAKVETGPIWDDVGGLKGINWKTTPAPDFSFINETPG
GGAHSTSHTGPGTPVGATVVPNVNVNLGGIKVDLGGINLGGITTNVTTEE
GGGTNITSTKSTSTDDKVSITSTGSQSTIEEDTIQFDDPGQGEDDNAIPG
TNTPPPPGPPPNLSSSRLLTISNASLNQVLQNVRQHLNTAYDSNGNSVSD
LNQDLGQVVKNSENGVNFPTVILPKTTGDTDPSGQATGGVTEGGGHIRNI
IQRNTQSTGQSEGATPTPQPTIAKIVTSLRKANVSSSSVLPQPQVATTIT
PQARTASTSTTSIGTGTESTSTTSTGTGTGSVSTQSTGVGTPTTTTRSTG
TSATTTTSSASTQTPQAPLPSGTRHVATISLVRNAAGRSIVLQQGGRSQS
FPIPPSGTGTQNMGAQLWAAASQVASTLGQVVNQAATAGSQPSSRRSSPT
SPRRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCTCCTATCAACCAACCATCGACAACGACTCAGATAACTCAAAC
TGGGCAGACTACAACGACAACAACGGTAGGATCATTAGGAGAGCATTCTG
TTACAACAACAGGATCTGGGGCAGCAGCACAAACATCTCAGACAGTAACT
CTAATTGCAGATCACGAAATGCAAGAAATTGCAAGTCAAGATGGATCCGC
GGTAAGCTTTTCTGCTGAGCACTCTTTTTCTACCCTCCCTCCAGAGACTG
GAAGTGTTGGAGCTACAGCACAATCCGCTCAATCTGCGGGGCTATTTTCA
TTATCAGGTCGTACACAAAGAAGAGATTCGGAGATTTCTTCCTCTTCTGA
CGGCAGTTCGATATCTAGAACTAGCTCAAACGCATCTTCTGGAGAAACAA
GCAGAGCTGAAAGTAGTCCTGATCTAGGCGACTTGGATAGCTTATCAGGA
AGCGAGCGCGCTGAAGGAGCCGAAGGACCTGAAGGACCTGGAGGCTTACC
TGAAAGTACGATTCCACATTATGATCCTACCGATAAAGCGTCTATTTTGA
ACTTCTTGAAAAATCCTGCAGTTCAGCAGAAAATGCAGACCAAAGGAGGC
CACTTTGTTTATGTAGATGAAGCCAGAAGTAGTTTCATTTTTGTCCGCAA
TGGTGACTGGTCAACTGCTGAGTCTATAAAAGTTTCTAATGCAAAAACCA
AAGAAAATATTACTAAGCCTGCGGACTTAGAAATGTGCATCGCTAAATTC
TGTGTGGGATATGAAACCATCCACTCGGATTGGACGGGACGCGTAAAACC
TACAATGGAAGAGCGCTCGGGAGCCACAGGAAATTACAATCATCTGATGC
TCAGCATGAAATTTAAAACTGCTGTAGTCTACGGTCCTTGGAATGCTAAA
GAATCTAGTAGTGGATATACACCCTCTGCATGGCGTCGTGGAGCAAAAGT
AGAAACAGGTCCGATTTGGGATGATGTTGGGGGCTTGAAAGGCATTAACT
GGAAAACGACCCCAGCTCCAGACTTCTCCTTTATAAATGAAACTCCAGGT
GGAGGGGCTCACTCGACGTCTCATACAGGTCCTGGCACTCCAGTAGGAGC
TACTGTGGTTCCTAATGTGAATGTCAACTTGGGAGGCATTAAGGTTGATC
TGGGTGGCATCAATTTAGGTGGAATTACAACGAATGTCACTACAGAAGAA
GGTGGTGGAACCAACATAACATCTACGAAATCCACATCTACTGATGATAA
AGTCTCAATAACATCTACAGGATCTCAAAGTACGATCGAAGAAGACACTA
TACAATTTGACGATCCTGGTCAGGGAGAGGATGATAACGCAATTCCCGGC
ACAAACACACCTCCTCCTCCAGGTCCTCCGCCAAATCTAAGCAGTTCTCG
CTTGCTGACTATTTCGAATGCGTCCTTGAACCAAGTCTTACAGAATGTCC
GACAACATCTGAATACGGCTTATGATTCGAATGGTAATTCAGTCTCAGAT
CTCAATCAGGATTTAGGCCAGGTAGTAAAAAACAGTGAAAACGGAGTGAA
CTTCCCTACTGTGATTCTTCCTAAAACTACTGGCGATACAGATCCATCCG
GTCAAGCAACCGGAGGAGTCACTGAAGGCGGCGGTCATATCCGTAATATT
ATCCAAAGGAATACACAATCTACGGGGCAAAGTGAAGGAGCAACACCTAC
ACCTCAACCTACTATAGCAAAGATAGTGACTTCCCTGAGAAAAGCAAATG
TAAGTTCCAGCTCTGTGCTACCACAACCACAAGTAGCTACGACGATCACC
CCTCAAGCGAGAACGGCCAGTACATCTACAACGAGCATAGGAACCGGGAC
AGAAAGCACATCTACAACAAGTACGGGAACGGGAACAGGAAGTGTCTCCA
CACAAAGTACTGGCGTAGGGACACCAACTACGACGACTCGATCTACAGGA
ACTTCGGCGACAACCACAACATCATCAGCTTCGACACAAACACCCCAAGC
GCCTCTTCCCTCTGGGACCAGGCATGTTGCTACAATCTCCTTAGTGCGTA
ATGCTGCAGGAAGGTCTATTGTATTACAACAAGGGGGTCGATCTCAAAGC
TTCCCGATCCCTCCCTCAGGGACTGGAACACAGAATATGGGGGCACAATT
GTGGGCTGCAGCAAGTCAAGTTGCTTCCACTTTAGGCCAGGTCGTGAATC
AAGCAGCTACAGCAGGTTCTCAACCCTCCTCTCGTAGATCTTCCCCAACA
AGTCCACGAAGAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy