Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR457 IGR456 IGR455 CPn0575 CPn0573 murA, - CPn0571 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0575 CPn0573 murA, - CPn0571 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0573 murA, - CPn0571 CPn0574 CPn0575 CPn0574 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0571

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murA  

Definition:
UDP-N-acetylglucosamine-1-carboxyvinyltransferase

Gene Start:
662122

Gene Stop:
660746

Gene Length:
1377

Molecular Weight*:
49318

pI*:
6.60

Net Charge*:
-3.75

EC:
2.5.1.7  

Functional Class:
cell envelope; peptidoglycan  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0571 is orthologously related to CT455: residues 5-434 of CPn0571 are 70% similar to residues 5-434 of CT455, a predicted UDP-N-acetylglucosamine-1-carboxyvinyltransferase from C. trachomatis.
CPn0571 is also similar to TP0029, a predicted enol-pyruvyltransferase from T. pallidum. Also, residues 86-104 of CPn0571 are 57% similar to residues 122-140 of CT374, a predicted arginine/ornithine antiporter.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0766
COG name: UDP-N-acetylglucosamine enolpyruvyl transferase
Functional Class:  M
The phylogenetic pattern of COG0766 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 427 (E-value = 5.6e-157) place CPn0571 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
89  
106
transmembrane  
167  
184
transmembrane  
239  
256
transmembrane  
364  
381
transmembrane  
386  
403

PDB Hit:


Gene Protein Sequence:
MQIAQVFGCGRLNGEVKVSGAKNAATKLLVASLLSDQKCTLRNVPDIGDV
SLTVELCKSLGAHVSWDKETEVLEIYTPEIQCTRVPPTFSNVNRIPILLL
GALLGRCPEGVYVPTVGGDAIGERTLNFHFEGLKQLGVQISSDSSGYYAK
APRGLKGNYIHLPYPSVGATENLILAAIHAKGRTVIKNVALEAEILDLVL
FLQKAGADITTDNDRTIDIFGTGGLGSVDHTILPDKIEAASFGMAAVVSG
GRVFVRNAKQELLIPFLKMLRSIGGGFLVSESGIEFFQERPLVGGVVLET
DVHPGFLTDWQQPFAVLLSQAQGSSVIHETVHENRLGYLHGLQHMGAECQ
LFHQCLSTKACRYAIGNFPHSAVIHGATPLWASHLVIPDLRAGFAYVMAA
LIAEGGGSIIENTHLLDRGYTNWVGKLRSLGAKIQIFDMEQEELTTSPKS
LALRDASL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGATTGCTCAAGTATTTGGTTGTGGTAGACTTAATGGTGAGGTAAA
AGTTTCAGGAGCAAAAAATGCTGCAACTAAGCTGCTTGTTGCTTCTTTAC
TTTCTGATCAGAAGTGCACACTGCGGAATGTCCCCGATATAGGAGATGTT
TCCTTAACTGTAGAGTTATGCAAGTCGCTAGGAGCACATGTTTCTTGGGA
TAAGGAAACAGAGGTTTTGGAAATCTATACTCCCGAAATACAATGCACAA
GAGTTCCTCCCACATTTTCAAATGTCAATAGGATCCCCATCCTTTTATTA
GGAGCGCTGTTAGGGCGTTGCCCTGAAGGTGTCTATGTTCCCACTGTGGG
GGGAGATGCTATAGGAGAAAGGACCTTAAACTTTCATTTTGAAGGGTTAA
AACAACTTGGTGTGCAGATTTCCTCTGATAGTTCGGGATACTACGCAAAG
GCTCCTCGAGGTCTTAAAGGGAATTATATTCATCTACCCTATCCTTCTGT
AGGGGCTACAGAAAATCTCATACTCGCAGCAATTCATGCTAAAGGAAGAA
CGGTTATAAAAAATGTAGCTCTCGAAGCTGAAATCTTAGATTTGGTGCTC
TTTTTGCAAAAGGCAGGGGCGGATATCACTACCGATAATGATCGTACGAT
AGATATTTTTGGCACTGGAGGTCTCGGCTCTGTAGACCACACCATCCTTC
CAGATAAGATTGAAGCAGCCTCTTTTGGAATGGCCGCGGTTGTCTCTGGA
GGACGTGTTTTCGTCCGAAATGCTAAACAAGAACTTCTGATTCCCTTCCT
CAAGATGTTGCGCTCCATAGGCGGAGGATTTTTGGTCTCCGAGTCGGGAA
TAGAATTTTTTCAAGAACGCCCCTTGGTGGGAGGTGTTGTCTTGGAAACC
GATGTTCATCCAGGGTTCCTGACGGACTGGCAACAACCCTTCGCAGTTCT
ACTATCACAGGCTCAGGGATCTTCAGTAATCCATGAGACTGTCCATGAAA
ATCGCCTCGGCTACCTTCATGGTCTTCAGCACATGGGAGCTGAGTGTCAG
CTTTTTCATCAGTGCTTAAGTACCAAGGCATGTCGTTATGCTATCGGGAA
TTTTCCTCACAGCGCTGTGATTCATGGGGCGACGCCTTTATGGGCCTCGC
ATTTAGTCATTCCAGATTTACGAGCAGGATTTGCCTATGTCATGGCAGCA
CTGATTGCAGAAGGAGGAGGCTCTATTATTGAGAACACTCATCTTCTAGA
TCGTGGATATACAAATTGGGTAGGCAAGCTCAGAAGCCTCGGAGCTAAAA
TTCAGATCTTTGATATGGAACAGGAAGAACTTACAACCTCTCCAAAGTCT
TTAGCCCTAAGAGATGCATCCCTGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy