Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR456 IGR455 IGR452 CPn0573 CPn0565 murA, - CPn0571 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0573 CPn0565 murA, - CPn0571 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0573 CPn0565 murA, - CPn0571 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0570

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argS  

Definition:
arginyl-tRNA transferase

Gene Start:
659107

Gene Stop:
660792

Gene Length:
1686

Molecular Weight*:
63359

pI*:
5.80

Net Charge*:
-12.23

EC:
6.1.1.19  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism M
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
The E.coli enzyme is believed to be a monomer that belongs to the Class I aminoacyl-tRNA synthetases.
Reaction: ATP + l-arginine + tRNA(arg) = AMP + pyrophosphate + l-arginyl-tRNA(arg).


Blast Summary:  PSI-Blast Search
CPn0570 is orthologously related to CT454: residues 1-561 of CPn0570 are 71% similar to residues 1-563 of CT454, a predicted arginyl-tRNA synthetase from C. trachomatis.
CPn0570 is also similar to TP0831, UU278.


COGS Summary:  COGS Search
BeTs to 17 clades of COG0018
COG name: Arginyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0018 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 88 (E-value = 8.1e-33) place CPn0570 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 96 to 434 (E-value = 2e-107) place CPn0570 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 448 to 561 (E-value = 2.8e-39) place CPn0570 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17
coil-coil  
368  
395
non-globular  
438  
519

PDB Hit:


Gene Protein Sequence:
MSTLLSILSVICSQAIAKAFPNLEDWAPEITPSTKEHFGHYQCNDAMKLA
RVLKKAPRAIAEAIVAELPQEPFSLIEIAGAGFINFTFSPVFLNQQLEHF
KDALKLGFQVSQPKKIIIDFSSPNIAKDMHVGHLRSTIIGDSLARIFSYV
GHDVLRLNHIGDWGTAFGMLITYLQENPCDYSDLEDLTSLYKKAYVCFTN
DEEFKKRSQQNVVALQAKDPQAIAIWEKICETSEKAFQKIYDILDIVVEK
RGESFYNPFLPEIIEDLEKKGLLTVSNDAKCVFHEAFSIPFMVQKSDGGY
NYATTDLAAMRYRIEEDHADKIIIVTDLGQSLHFQLLEATAIAAGYLQPG
IFSHVGFGLVLDPQGKKLKTRSGENVKLRELLDTAIEKAEEALREHRPEL
TDEAIQERAPVIGINAIKYSDLSSHRTSDYVFSFEKMLRFEGNTAMFLLY
AYVRIQGIKRRLGISQLSLEGPPEIQEPAEELLALTLLRFPEALESTIKE
LCPHFLTDYLYNLTHKFNGFFRDSHIQDSPYAKSRLFLCALAEQVLATGM
HLLGLKTLERL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGACATTACTTTCTATCTTATCTGTGATATGTTCTCAGGCAATAGC
AAAGGCATTTCCTAATCTAGAAGATTGGGCTCCAGAAATTACCCCGTCTA
CAAAAGAACATTTTGGCCATTATCAATGTAACGATGCGATGAAATTGGCT
CGTGTTTTAAAAAAAGCTCCGAGGGCTATTGCTGAGGCCATAGTAGCTGA
GCTTCCTCAAGAGCCTTTTTCTTTAATTGAAATTGCTGGAGCAGGATTTA
TAAACTTTACCTTCTCTCCAGTATTTCTAAATCAACAGCTAGAACATTTC
AAGGACGCTCTAAAATTAGGATTTCAAGTTTCCCAACCTAAAAAAATTAT
CATTGATTTTTCCTCTCCAAATATTGCTAAAGACATGCATGTTGGGCATT
TACGCTCTACAATTATTGGGGATAGCCTTGCTAGGATCTTCTCCTATGTA
GGTCATGATGTACTTAGACTCAATCATATCGGAGATTGGGGAACTGCATT
TGGGATGTTGATCACCTATTTGCAAGAAAATCCCTGTGACTATAGTGATC
TTGAGGATCTTACGAGTCTTTATAAGAAGGCCTATGTCTGCTTTACTAAT
GACGAAGAGTTTAAAAAACGCTCCCAACAGAATGTGGTAGCATTACAGGC
TAAGGATCCGCAAGCCATTGCTATTTGGGAGAAGATCTGTGAGACTTCGG
AAAAAGCCTTCCAGAAAATCTATGATATTTTGGACATCGTGGTTGAAAAA
CGCGGAGAATCTTTCTATAACCCTTTCCTTCCTGAAATTATCGAAGATCT
AGAGAAGAAAGGCCTTCTCACTGTTTCCAACGATGCTAAATGTGTATTTC
ATGAAGCCTTTTCGATTCCTTTTATGGTTCAAAAAAGTGATGGGGGCTAC
AACTACGCCACCACAGATCTTGCTGCGATGCGCTATCGCATAGAGGAAGA
TCATGCCGATAAGATCATCATTGTTACTGACTTAGGTCAGTCTCTACATT
TCCAACTCCTTGAGGCTACAGCAATTGCTGCGGGCTATCTACAACCTGGA
ATATTTTCTCATGTAGGCTTTGGCCTTGTCTTAGATCCTCAAGGGAAGAA
ACTTAAAACCCGCTCTGGAGAAAACGTAAAGCTCCGAGAGCTTCTAGATA
CTGCTATTGAAAAAGCTGAAGAAGCATTGCGAGAACATCGACCCGAACTT
ACGGATGAGGCAATCCAAGAAAGAGCTCCCGTCATTGGAATCAACGCTAT
AAAATACAGTGATCTCTCTTCCCATCGCACTAGCGACTATGTCTTTTCTT
TTGAAAAGATGCTCCGCTTCGAAGGAAACACCGCCATGTTTCTACTGTAT
GCCTACGTGCGAATCCAAGGAATTAAACGTCGTTTAGGAATTTCTCAGCT
GTCATTAGAGGGACCTCCGGAGATTCAAGAACCTGCTGAAGAGTTGCTTG
CATTAACTTTGCTACGCTTCCCCGAAGCTTTAGAGAGCACAATTAAAGAG
TTGTGTCCTCATTTTCTTACAGATTATCTTTATAATCTCACCCATAAATT
CAATGGGTTCTTCCGTGACAGCCATATCCAAGACTCCCCTTATGCTAAGT
CTAGACTGTTTCTATGTGCTCTAGCTGAACAAGTCTTGGCTACAGGGATG
CATCTCTTAGGGCTAAAGACTTTGGAGAGGTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy