Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR451 IGR455 IGR452 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0569

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
plsC  

Definition:
1-acyl-sn-glycerol-3-phosphate acyltransferase

Gene Start:
658464

Gene Stop:
659102

Gene Length:
639

Molecular Weight*:
24434

pI*:
10.40

Net Charge*:
16.14

EC:
2.3.1.51  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:
The PLSC protein, in E.coli and M. genitalium, is involved in phospholipid
biosynthesis, converting acyl-CoA and 1-acyl-SN-glycerol 3-phosphate to CoA +
1,2-diacyl-SN-glycerol 3-phosphate.

Blast Summary:  PSI-Blast Search
Pn0569 is orthologous to CT453, a predicted 1-acyl-sn-glycerol-3-phosphate acyltransferase:
residues 1-212 are 46% similar to CT453. No similarity to T.pallidum,
M.genitalium, U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0204
COG name: 1-acyl-sn-glycerol-3-phosphate acyltransferase
Functional Class:  I
The phylogenetic pattern of COG0204 is ----YQvCEbRhujgpolINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 19 to 141 (E-value = 2.5e-23) place CPn0569 in the Acyltransferase family which is described as Acyltransferase (PF01553)

PDB Hit:


Gene Protein Sequence:
MIFRICKFFTWVAFSLFYKLKVYGVKKNFIKGPAIIAVNHNSFLDPIALH
MCVHECIYHLARASLFNIPWLWKQWGCFPVRQDEGNSAAFKIASRLFNKR
KKLVIYPEGARSPDGQLQPGKVGIGMMAAKSRVPIIPVYIRGTFEAFNRH
QKIPHVWKTITCVFGTPMYFDDIIQNPEIKNKETYQIITNQTMNKIAELK
AWYESGCKGDVP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTTCCGCATTTGTAAATTTTTCACGTGGGTAGCTTTTTCTCTTTT
CTATAAGCTAAAAGTTTATGGAGTGAAAAAAAATTTTATTAAAGGTCCTG
CTATTATTGCAGTAAACCATAATTCTTTTTTAGACCCCATAGCATTGCAC
ATGTGTGTCCATGAGTGTATTTATCACCTAGCACGGGCCTCTTTATTTAA
TATCCCCTGGTTATGGAAGCAATGGGGGTGTTTTCCCGTGCGTCAAGACG
AAGGAAACTCTGCGGCATTTAAAATTGCCTCTCGGCTCTTTAATAAACGA
AAGAAGTTAGTGATCTATCCAGAGGGGGCTCGAAGCCCTGACGGTCAACT
CCAGCCTGGCAAGGTCGGTATTGGTATGATGGCTGCAAAATCTAGAGTTC
CGATCATCCCTGTCTATATTAGGGGAACTTTTGAAGCTTTTAACCGTCAT
CAAAAAATTCCTCATGTTTGGAAAACGATCACGTGTGTTTTCGGTACTCC
CATGTATTTTGATGATATTATTCAAAATCCCGAGATCAAAAATAAAGAAA
CCTATCAGATCATCACGAATCAAACTATGAACAAAATTGCCGAGCTCAAA
GCATGGTATGAATCGGGGTGCAAAGGAGACGTCCCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy