Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR451 IGR455 IGR452 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0568

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
657817

Gene Stop:
658467

Gene Length:
651

Molecular Weight*:
24065

pI*:
5.80

Net Charge*:
-3.13

EC:
2.7.4.14  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Pyrimidine metabolism

Comment:
This enzyme converts CMP to CDP.

Blast Summary:  PSI-Blast Search
CPn0568 is orthologously related to CT452, a predicted cytidylate kinase:
residues 1-211 are 68% similar to CT452. CPn0568 is also similar
to MG330, UU342 and TP0279.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0283
COG name: Cytidylate kinase
Functional Class: F
The phylogenetic pattern of COG0283 is -----qvcebrH--gpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 53 to 209 (E-value = 6.5e-89) place CPn0568 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
110

PDB Hit:


Gene Protein Sequence:
MIITIDGPSGTGKSTTAKALADHLHFNYCNTGKMYRTLAYARLQSPWATL
PLTKFLEEPPFSFTFATGQPLESFFNGHLLTSELTTQEVANAASELSQLP
EVRAFMQDLQRRYAQLGNCVFEGRDMGSKVFPNADLKIFLTSSPEVRAQR
RLKDLPEGTLSPEQLQAELVKRDAADAQRAHDPLVIPENGIVIDSSDLTI
RQVLEKILALLFRNEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATCACTATTGATGGGCCTTCAGGAACAGGAAAAAGCACAACAGC
GAAAGCTTTAGCCGACCATCTTCATTTCAATTACTGTAATACAGGGAAGA
TGTATCGCACTTTAGCCTATGCTCGTTTACAATCTCCCTGGGCGACGCTT
CCTTTAACTAAATTTTTAGAAGAGCCTCCTTTTTCTTTTACCTTTGCTAC
AGGCCAACCTTTAGAGTCGTTTTTTAATGGTCATCTTCTTACCTCTGAAT
TAACAACTCAAGAAGTTGCGAACGCAGCATCGGAGCTCTCTCAACTTCCA
GAAGTTCGTGCATTCATGCAAGATTTGCAACGACGCTATGCTCAGCTTGG
CAACTGTGTATTTGAAGGAAGGGATATGGGATCCAAAGTCTTTCCCAACG
CAGATTTAAAAATTTTTCTAACTTCAAGTCCTGAAGTTCGTGCGCAACGG
CGTTTAAAAGACCTTCCTGAAGGGACTCTTTCTCCTGAGCAATTGCAAGC
AGAGCTTGTCAAACGTGATGCTGCAGATGCACAACGCGCTCACGATCCCC
TAGTCATCCCTGAAAATGGAATTGTAATTGACTCTTCGGATTTGACAATA
AGACAAGTTCTGGAGAAAATTTTAGCTTTACTATTTCGAAACGAGCTATG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy