Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR451 IGR455 IGR452 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0572 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0567

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cdsA  

Definition:
phosphatidate cytidylytransferase (CDP diglyceride synthetase)

Gene Start:
656894

Gene Stop:
657820

Gene Length:
927

Molecular Weight*:
33985

pI*:
10.50

Net Charge*:
13.33

EC:
2.7.7.41  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:
This enzyme, an integral membrane protein, catalyzes the conversion of
phosphatidate to CDP-diacylglycerol.

Blast Summary:  PSI-Blast Search
CPn0567 is orthologous to CT451, a predicted phosphatidate cytidylytransferase:
residues 16-308 are 55% similar to CT451.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0575
COG name: CDP-diglyceride synthetase
Functional Class:  I
The phylogenetic pattern of COG0575 is amtkyqvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 18 to 301 (E-value = 2.5e-84) place CPn0567 in the CTP_transf_1 family which is described as Cytidylyltransferase family (PF01148)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
24  
48
transmembrane  
76  
93
transmembrane  
104  
121
transmembrane  
134  
154
transmembrane  
165  
184
transmembrane  
209  
233
transmembrane  
238  
256
transmembrane  
285  
302

PDB Hit:


Gene Protein Sequence:
VLNSNKFKSKTGAYGDLFQRVVVHSLVLTFLVLLLYSSLFPLTSFALGFI
TATCGAVGTYEYSSMAKAKMHYPLSTFSAIGSFLFLALSFLSIRWGHSLP
GFFDALPWTLLIVWVVWSIFRVRKSTIGALQLSGVTLFSILYVGIPIRLF
LHVLYSFIHTQEPYLGIWWASFLIATTKGADIFGYFFGKAFGNKKIAPQI
SPNKTVVGFVAGCLGATLISFIFFLQIPTRFASYFPMPAILIPLGLALGI
TGFFGDIIESIFKRDAHLKNSNKLKAVGGMLDTLDSLLLSTPIAYLFLLI
TQSKEFIG$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTAATTCAAATAAGTTTAAATCGAAGACCGGTGCATACGGTGATTT
ATTTCAGCGTGTTGTTGTTCATTCGTTAGTACTTACATTTTTGGTTCTTC
TTCTCTATAGTTCCCTATTTCCCTTAACTTCTTTTGCTCTAGGGTTTATT
ACCGCGACTTGTGGCGCTGTAGGAACTTATGAGTACTCCTCAATGGCGAA
AGCCAAGATGCACTATCCATTAAGCACGTTTAGTGCGATCGGATCTTTTT
TATTTTTAGCATTAAGTTTTCTTTCCATTCGTTGGGGACACAGTCTCCCA
GGATTCTTCGATGCTCTTCCTTGGACCTTGCTTATTGTTTGGGTCGTGTG
GAGTATCTTTAGAGTTCGAAAATCTACAATCGGCGCTTTACAGCTATCAG
GAGTCACTCTCTTTTCTATTTTGTATGTAGGGATTCCGATACGTTTATTC
TTACATGTCCTTTATAGCTTTATTCATACCCAAGAACCCTATCTTGGAAT
TTGGTGGGCTTCTTTTCTTATTGCCACAACTAAAGGTGCGGATATCTTCG
GTTATTTCTTCGGTAAAGCCTTTGGGAATAAGAAAATCGCCCCACAAATT
AGCCCTAACAAAACTGTTGTAGGTTTTGTTGCAGGGTGTTTGGGAGCCAC
GCTCATTAGTTTTATTTTCTTTCTACAGATTCCCACGAGGTTTGCGAGTT
ACTTCCCGATGCCTGCGATTTTAATTCCTTTAGGTCTTGCTTTAGGAATC
ACAGGATTTTTTGGAGATATTATTGAATCCATATTTAAGCGTGATGCTCA
TTTGAAAAATAGCAACAAGCTCAAGGCTGTGGGTGGTATGCTGGATACCT
TAGACTCACTGCTCCTGTCCACGCCGATTGCTTACTTATTTTTGCTCATA
ACCCAATCTAAAGAGTTTATTGGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy