Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR451 IGR452 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0565 murA, - CPn0571 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0566

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (YAES-related)

Gene Start:
656141

Gene Stop:
656893

Gene Length:
753

Molecular Weight*:
28646

pI*:
8.00

Net Charge*:
2.55

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Predicted YaeS family protein (yaeS).

Blast Summary:  PSI-Blast Search
CPn0566 is orthologously related to CT450: residues 1-250 of CPn0566 are 62% similar to residues 1-253 of CT450, a predicted conserved hypothetical protein (YaeS-related) from C. trachomatis.
CPn0566 is also similar to TP0603, a predicted conserved hypothetical protein from T. pallidum.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0020
COG name: Undecaprenyl pyrophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0020 is AmtkYqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 25 to 250 (E-value = 9.8e-89) place CPn0566 in the UPP_synthetase family which is described as Putative undecaprenyl diphosphate synthase (PF01255)

PDB Hit:


Gene Protein Sequence:
LSLATNNAESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHTSGHYY
GAKVLPNILNAVLDLGIKVLTLYTFSTENFGRPKEEIQEIFNIFYTQLDK
QLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNY
GGKDELVRAFKKLHVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRT
GGEMRVSNFLLWQIAYTELYITDTLWPDFTPQDLFEAINVYQQRSRRGGK
$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTCTTTAGCTACCAACAATGCTGAATCCAAGTTCCCCTCTCTACAGCG
CCTTCCCAACCATGTTGCTATCATTATGGACGGCAATCGCCGATGGTACA
AAAAGCATAGGGAGGAGTGCGGCCACACACACACGTCAGGTCATTATTAT
GGCGCTAAAGTCCTTCCAAATATTTTAAATGCGGTTCTTGATTTAGGAAT
TAAAGTTCTTACTCTCTATACGTTTTCAACAGAAAATTTTGGGAGACCAA
AAGAGGAAATTCAAGAAATATTTAATATTTTCTATACTCAGTTAGACAAG
CAACTTCCTTATCTAATGGAAAATGAAATCTGCTTACGTTGTATAGGAGA
CCTTTCCAAGCTCCCTAAAGGCATCCAAACGAAAATCAACCATGTGAGTC
GCATGACGGCATCGTTCTCGCGTTTAGAGCTCGTATTAGCTGTCAACTAC
GGTGGCAAAGATGAGTTAGTCCGTGCATTTAAAAAATTACATGTTGATAT
TCTAAATAAAAAAATATCTTCTGACGACCTTTCAGAATCTTTGATTAGCT
CATACTTAGATACTTCAGGACTTACGGACCCCGACTTACTTATCCGTACA
GGGGGTGAAATGCGTGTCAGTAATTTCTTATTGTGGCAAATAGCATATAC
AGAACTATATATCACGGATACCTTGTGGCCAGATTTTACGCCTCAAGATT
TGTTTGAAGCGATTAACGTATACCAGCAAAGATCAAGACGAGGGGGGAAA
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy