Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR454 IGR450 IGR451 IGR452 CPn0565 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0565 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 CPn0565 secF,secD, - CPn0564 plsC, - CPn0569 CPn0566 cdsA, - CPn0567 argS, - CPn0570 cmk, - CPn0568 cmk, - CPn0568
* Calculated from Protein Sequence

Gene ID: CPn0565

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
655630

Gene Stop:
654530

Gene Length:
1101

Molecular Weight*:
41128

pI*:
8.00

Net Charge*:
4.27

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
38  
55
transmembrane  
60  
81

PDB Hit:


Gene Protein Sequence:
MKFPRISISDLIPTQMVIWWRGGGNVHYVPNAQNLPKKILGGVLACFGLA
LLGCAAFAAGVCQTIFPCIGLMILGLVLLGFAYLQYSKGWSRFERPLFRE
TKVFEKPINWLGCLSLLQSWKKIRPGCYYHPGCPQVEICEGSQEIVTKIF
QKKSDRNTSIFLIQEMDQIALRQGIEKSSLSRKTFAIDPSVVSSLLSEIQ
REEQQYLDPKVISWSSEDQASDRTHPKSAIYVNISDAAQEPQGRCYIDAY
TKAFFTVLDQIGDPNIVKKHTIYVLTPILGVPDALPKEEQENLKLLSQAA
FLYSAEQVAKRMREEKQDSIRIKFIFTDPTSPTSLYFSPHHSSTPHSVTP
ISLSGFVGEQESYTFA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTCCTCGCATATCCATTTCAGATTTGATTCCCACTCAAATGGT
CATTTGGTGGCGCGGAGGAGGCAATGTCCACTACGTCCCCAATGCACAAA
ACCTGCCGAAGAAAATACTGGGCGGTGTTTTAGCTTGTTTTGGTTTGGCG
TTGTTAGGATGTGCTGCCTTCGCTGCTGGGGTATGTCAAACCATTTTCCC
GTGCATAGGTCTTATGATTCTGGGATTGGTTCTTTTAGGGTTTGCGTACT
TACAATACTCTAAGGGATGGTCACGATTCGAGCGTCCTCTATTTCGAGAA
ACTAAGGTCTTTGAAAAACCTATAAATTGGTTAGGATGCCTCTCTCTCTT
GCAGTCTTGGAAAAAAATACGACCCGGATGCTACTATCATCCAGGCTGTC
CCCAAGTAGAGATCTGCGAAGGCTCCCAGGAGATCGTTACTAAGATATTC
CAGAAAAAATCCGATAGAAATACCAGTATCTTTCTGATCCAAGAAATGGA
TCAGATCGCATTAAGACAGGGGATCGAAAAAAGCTCCTTATCACGCAAAA
CTTTTGCTATAGATCCTTCTGTAGTGTCTTCGTTGCTCTCTGAAATCCAA
AGAGAGGAACAGCAATATTTGGATCCTAAAGTCATTTCCTGGAGCTCAGA
AGACCAAGCTAGTGACCGCACGCATCCTAAAAGCGCGATTTATGTAAATA
TTTCTGACGCAGCCCAGGAACCTCAGGGAAGATGTTATATCGATGCCTAT
ACTAAAGCATTTTTTACTGTGTTAGATCAAATCGGCGATCCTAATATAGT
GAAAAAACATACGATCTACGTACTCACTCCTATCCTTGGAGTTCCTGATG
CACTCCCTAAAGAGGAACAGGAAAACCTAAAACTGCTCTCACAAGCCGCT
TTCCTCTACTCTGCAGAGCAGGTGGCAAAACGAATGAGAGAAGAGAAACA
AGATTCCATTCGGATAAAGTTTATTTTCACAGATCCCACAAGCCCAACCT
CACTGTATTTTTCCCCTCATCACTCCTCAACCCCGCATAGTGTAACTCCT
ATTTCGCTTTCTGGTTTTGTTGGCGAACAAGAGAGCTATACTTTTGCCTA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy